KEGG   Microplitis demolitor: 103569646Help
Entry
103569646         CDS       T05600                                 

Definition
(RefSeq) aldehyde dehydrogenase, dimeric NADP-preferring isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mdl  Microplitis demolitor
Pathway
mdl00010  Glycolysis / Gluconeogenesis
mdl00053  Ascorbate and aldarate metabolism
mdl00071  Fatty acid degradation
mdl00280  Valine, leucine and isoleucine degradation
mdl00310  Lysine degradation
mdl00330  Arginine and proline metabolism
mdl00340  Histidine metabolism
mdl00380  Tryptophan metabolism
mdl00410  beta-Alanine metabolism
mdl00561  Glycerolipid metabolism
mdl00620  Pyruvate metabolism
mdl00981  Insect hormone biosynthesis
mdl01100  Metabolic pathways
Module
mdl_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103569646
   00053 Ascorbate and aldarate metabolism
    103569646
   00620 Pyruvate metabolism
    103569646
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103569646
   00561 Glycerolipid metabolism
    103569646
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103569646
   00310 Lysine degradation
    103569646
   00330 Arginine and proline metabolism
    103569646
   00340 Histidine metabolism
    103569646
   00380 Tryptophan metabolism
    103569646
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103569646
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    103569646
Enzymes [BR:mdl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103569646
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 103569646
NCBI-ProteinID: XP_008545252
Position
Unknown
AA seq 550 aa AA seqDB search
MATEVVVDMVPDQESESKLNHPVDDKVAQINIEIEDTDSTTMNGKPVLLNHADMVQKTRD
AFYSGKTRALKWRIHQIKQLRRMLEENTEQFHSALKSDLRRSKFENCCLEIDYTLNEITH
MLRHIKEWSAVEKPPKDLVNILDSPEIHKDPYGVVLVIGAWNYPLQLLLVPVIGAIAAGN
CVIMKPSEVSPATADTIARLVPKYLDTECYHVVLGGVAETSELLKQKFDYIFYTGSGNVG
KIIREAANKYLTPVTLELGGKSPVWIDNTADLDITVKRVLWGKFINAGQTCIAPDYVLCT
KEIEVKFIERAKKIIKDWYGDNPKLSMDLCRIINQNHYQRLANLLINSGKVAVGGDLDPQ
ENYISPTILVDVKPSDPIMQQEIFGPILPIVNVSNAYEAIKFINERDCPLVMYIFSKDRE
TRDLFINQTHSGAICCNDTIMQYAVDSLPFGGVGGSGMGAYHGKLTYDTFTHKKSVLVRD
TSYLGEVLASGRYPPYSDNKLKFLSLLLAKRPDIPGIKYLPHLIMFGLGVLATVGVRAAM
KEYGSPDDQQ
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgaagttgttgtagatatggtccccgaccaagagtcggagagtaaattaaat
catccagtagatgataaagtcgctcaaataaatattgaaattgaggatacggattcaacc
acgatgaatggaaaacctgttttgttaaatcacgctgacatggttcaaaaaaccagagac
gcattttatagcggaaaaacacgagctttgaaatggagaattcatcagataaaacagctc
aggaggatgctggaagaaaatactgagcagtttcattcggcattaaagtctgatttaaga
aggagtaaattcgaaaactgttgccttgaaatagattacacattgaatgagatcacgcat
atgctgaggcacataaaagagtggtcagctgtcgaaaagcccccaaaagatctagtaaac
attcttgactcaccagaaattcataaagatccttatggtgttgttttagtcatcggagca
tggaattatccgctgcaattattattagtaccagttattggtgctattgctgcgggtaat
tgcgttattatgaaaccatcagaagtatctccagcaactgctgatacaattgcccgtttg
gtgccgaaatatttagatactgaatgttatcatgtcgtactcggtggtgttgctgagaca
tctgaattattgaagcaaaaatttgattatatattttacactggctctggtaatgttggt
aaaataattcgagaagctgctaataaatatttgacaccagtgacacttgaacttggtggt
aaaagtccggtatggattgataacacagcagacctagacattacagtgaaacgtgtactc
tggggtaaatttataaacgctggacaaacatgtattgcaccggattacgttctttgtaca
aaggaaattgaagttaaatttattgaacgcgctaaaaaaataataaaagattggtatggc
gacaatccgaaattgagcatggatttgtgccgtatcataaatcagaatcattatcagcga
cttgctaatttgttgataaacagcgggaaagttgccgtgggaggagatttagatccacag
gaaaattatatatcaccaacgattctcgttgatgttaaaccgagtgatccaataatgcaa
caggaaatttttggaccaatattacctatcgttaatgtatcgaatgcgtatgaagccatt
aagtttattaacgaacgcgactgtcccctcgtaatgtatatattttccaaggatcgagaa
acacgcgatctgtttataaaccaaacgcacagtggtgccatttgctgcaatgacacaata
atgcaatatgccgttgactccctgccattcggtggagtcggaggctctggaatgggagct
tatcatggtaaattgacttatgatacatttacacacaagaaaagtgtacttgtaagagat
actagttaccttggagaagtacttgcttcaggcagatacccgccgtacagtgacaacaaa
ttgaaattcttgagtctgctcttggccaagagacccgacatacccgggataaaatacttg
ccgcatttaattatgttcggattgggagtgctggctactgtgggggtcagagctgctatg
aaggaatatggatcaccagatgaccaacaataa

DBGET integrated database retrieval system