KEGG   Microplitis demolitor: 103569923Help
Entry
103569923         CDS       T05600                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
mdl  Microplitis demolitor
Pathway
mdl00562  Inositol phosphate metabolism
mdl01100  Metabolic pathways
mdl04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103569923
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    103569923
Enzymes [BR:mdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     103569923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka C2 PI3K_rbd PI3K_C2 PX DUF4135
Motif
Other DBs
NCBI-GeneID: 103569923
NCBI-ProteinID: XP_008545698
Position
Unknown
AA seq 1763 aa AA seqDB search
MSNHAKNDSVQRGNAIDYDKQFQEDLERAQALSLESLALEKFKMQRQLECSNNFLQNKFT
TQQCSFTNSGNNISEVDSSGSSDKLQLRSRPRPGGTQSKNSPIIAPPPVPCRRNSTTTVG
PTSSNTTDLINFTSPVKSESSLDEYCSGTSTVPSVSQPSIEPKWDTHPSLLKRTTRVSRS
NSSAAAYQTHDFRYHSPSPGPRASTAPCTPGTPGISPVITQTESVGDGIPQIPPLPMNYR
PPVGGPACASTKPIFPIDDGQLKVLKVIEKKPNNNLIDLSVFESIEDKTNVRVSVLEAFD
PLLIKTEEPNKELKPSKDESVSKVDGSLYDPFDPFDYMYSTNESVNSDPVYAAVEKTAMS
PTVSPAAPPLPPRNSSAWNTIEKRRTSLDRRRKRQTRLYENISVVKARGSLQDCDLKAFH
RMIKAVRSEFPFNDPGTNIGHVISPMMENLYPDGTSIKLVVHPQLSDNSVDSVPSITFTC
NVSCSVEHVILNVACSLEDNNIVSVEKYCLRVWGLAEYLAPNTTLAQYEYIHQCIKLEKD
IELAIITRAQIKRSIARSLQDDNRDQDLKLEDILPNEPLEPISYDTLIILLETVEKEMER
VETAAIQLASPNHSSSLLPQLQPRGVVQAVKAVCALMGNIETYEITEAVDNFVNACCQFL
PQMHTTNIECKKPEILHEDGDYSVVTLRTKFPEVLGSHCHKIRDAIQDLVETYCHAFRVD
FQLKLRGEYLTSTLVSSEVLDTVLVRVGSLHRLPNSWKHDDYIVAAQIFHGTRPVGNPVL
SEPMTLNVNFYSRILFNTWLEFRGISVCQVPREARLVLVIYGRTLQPTEHEANSSTEGSM
QKEELGWGAIQFFDYDGVMSQGNFFLSLWPAAADKRLGPAPAPGIHPYGETNPIIGLELP
DYGGRVLFPTELRDHDVESLDINLLDQNTKELLLDICQQDTFSRPPVDEREILWEKRHYL
HDIPEALPKVLLAAHSWDWACLPDLHASLRVWSPLPPVQALQLLLPCFPDIKVREMAVGW
IRELSNDELVDYLPQLLQALKHETYEASPLARFLLERALLSPRVAHHIYWLLTQSLPGQS
PQNSGETSQEDDKCISFTRYQRRLQLMLRALLAVIGEALRNSFLTQQLLVKNLNEIAENI
KTTKESLRMEALKLGLQNIHCQLAEDEGTCLPLSPSRQVFGINIQTCSYFPSFTLPLKIS
FISCDNVISPAIFKVGDDLQQDMLTLQMVRIMDKLWLKEGLDLKMVTFACVPTGNKRGMI
EMVTNAETLRKIQVEFGLTGSFKDRPIAEWLAKHNPSELEYERAVENFTASCAGYSVATY
ILGICDRHNDNIMLKTSGHLFHIDFGKFLGDAQMFGNFKRDRTPFVLTSDMAYVINGGDK
PSAKFHNFVDLCCQAFNIVRKHGNLILHLFGLMTSSGIPGVTMDAVSYVQKALLPGQTNP
EAAATFARMIESSLKNWFTQFNFFLHNLAQLRFTGDHNDGELLSFIPRTYTMQQEGQLTS
VQVHGYQKRYDPEKYYMYILRIQRKGQPDPTYLFRSYKEFCEFYQKLCIHFPLAKVASLP
SGMSVGRSNIKQVADKRRADIEKFLLSLFKMAPEISQSDLVYTFFHPLLRDQQNADIHLR
KVKVGNWWAEKRVRDNIQCGQIKLSLHYSRGTLSVMIHHARGLPKVANAQEPNTYVKVYL
KPDPTKATKRKTKVVKKNCHPSFMEMLEYRMPLEVIKERTLEATIWNHDTLQENEFLGGI
RLPLGHFDLNNETIEWFPLGSIR
NT seq 5292 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaccacgctaagaacgacagtgtccaacgggggaatgcgattgattatgataag
caatttcaggaagacttggaaagagcacaagctctcagtttggagagtttggctctggag
aaatttaaaatgcaaagacagttagaatgctctaataattttttacaaaataaatttact
acgcaacaatgtagttttacgaatagcggtaataatatttctgaagtagacagctcaggt
tcatcggataaattacaattaagaagtcgaccaaggccgggtggaacgcaatcaaaaaat
tctccgataatagcaccgccaccagtaccctgtcgtcgcaattcaacgacaacagttggc
ccgacatcatccaatacaactgaccttattaattttaccagtcccgttaaatcagagtct
agtttagacgaatattgtagtgggacatcgactgtcccgtcagtatcgcagccgtcaatt
gaacccaagtgggatactcatccttcgcttcttaaaagaacgacaagagtgtcgaggagc
aacagttctgcagcagcatatcaaactcatgactttcgttatcactcaccttccccagga
ccccgggcttctacggcgccttgcacgcctggtactccgggaataagtccagttataact
cagacagagagtgtcggtgatggtatacctcagatcccaccattgcctatgaattatcgc
ccaccagtaggtggtccagcgtgcgcgtcaacaaaaccaatattcccaatagatgacgga
cagctaaaagtattaaaagtaattgaaaaaaaaccaaataataatttgatagatctgagc
gtattcgagagtatagaagacaagacaaatgtacgagtgagtgtacttgaagcatttgat
cctctacttataaagactgaagaacccaacaaagaactaaaaccatcaaaagatgaatcc
gtcagtaaagttgatggatctctttacgacccgttcgatccctttgactacatgtacagc
acaaatgaaagtgttaattccgatccggtttatgctgcggtagaaaaaacggcaatgtca
ccaactgtgtcaccagcggcacccccactgcctccaagaaattcatctgcctggaatacg
atagaaaaacgacggacttcactagaccgacgacgaaaacgtcagactcgtttgtatgaa
aatatatcagttgtaaaagcgcgcggttcgttacaggattgtgatctgaaagcatttcat
cgtatgattaaagccgtgaggagtgaatttccttttaacgatccgggtacaaatattggt
catgtcatcagtcctatgatggagaatctttatccagacggaaccagtataaagttagtc
gtccatccgcaattgtcagacaattcagttgattcagtaccgtccataacttttacttgc
aacgttagttgtagcgtcgaacacgttattcttaatgtcgcttgttcattagaagataat
aatatcgttagtgttgaaaaatattgtctgagagtgtggggtctagctgaatatttagct
cccaacacgacattagcgcagtatgaatacattcatcagtgtattaaacttgaaaaggac
attgaattggcaattataacacgggcgcagataaaaagatcaatagcacgatcactacaa
gatgacaatagagatcaagatttaaaacttgaagatattcttcccaatgagcctttggag
cctatttcttatgacactttaattattttattggagactgttgaaaaagaaatggaacgt
gtagaaacagcggcaattcaacttgcgtcacctaatcacagctctagtcttttaccgcaa
ttgcagcccagaggtgttgtacaggctgtcaaagctgtgtgtgcgctgatgggtaacatc
gagacctatgaaataacggaagctgttgataatttcgtcaacgcatgctgtcaattttta
ccccaaatgcatacgaccaacattgaatgcaagaaacctgaaattcttcacgaagacggc
gattactcggtcgtaacactcaggacaaagtttcccgaagttctgggttctcattgtcac
aaaatacgcgacgctattcaagacctcgttgagacgtactgtcatgcattccgtgttgac
tttcaattgaaattacgtggcgagtatctgaccagcactttggtatcatcggaagtactg
gacactgtgctagtgcgcgttggatctttgcatcgactaccaaactcttggaaacacgac
gattatattgtagctgctcaaatattccatggaactcgacctgttggtaatcccgtgctc
tctgagcctatgactcttaatgttaatttttactcaagaatactcttcaatacctggtta
gaattccgtggtatcagcgtttgtcaagtacctcgtgaagcgagactagtactggttatt
tacggtcgcactttacagccaactgagcacgaagctaattcgtcgactgaaggatcgatg
caaaaagaagagttaggatggggcgcgatacagttttttgactacgatggagttatgagt
cagggtaattttttcttgtcactgtggccagctgctgctgacaaacgacttggtcctgca
ccagcacctggtattcatccttacggtgaaactaatcctattattggattagaacttcct
gattacggaggacgagtattatttcctaccgaattacgtgatcatgatgttgaatcactg
gacattaatttactggatcaaaatactaaagagttgctgctggatatttgtcagcaagac
actttttctcgaccgccagtcgatgaacgagaaattctatgggaaaaacgtcactatttg
catgatatacccgaagcattgccgaaagttttgctggctgctcatagctgggactgggca
tgtcttccagatcttcatgcttcactcagagtttggagcccactgccgcctgttcaagct
ctccagttacttctgccttgctttccagatatcaaagtacgagaaatggcagtcggttgg
attcgcgagctcagtaatgacgaacttgttgattatcttcctcaattacttcaagcatta
aaacatgaaacatacgaggcatctcctcttgctagatttttactagaacgagccttattg
tcaccacgtgtcgcccatcatatttactggcttttgactcagtcacttccaggacaaagt
cctcagaactctggtgagacatcgcaagaagatgataaatgtattagttttactcggtac
caaagaagactacaattgatgcttcgcgcactgctggcagtaatcggggaagctttgaga
aatagttttctaactcaacaattattagttaaaaatttaaatgaaatcgctgagaatatc
aagacaactaaagagtcattgcgaatggaagcattaaaattggggttgcaaaatattcat
tgtcagttagctgaagatgagggcacttgcttaccattgtcgccaagtagacaagtcttt
ggtataaatattcaaacttgttcatattttccatcgtttacattaccgttaaaaataagt
ttcatcagttgtgacaacgtcattagtccggctatttttaaagtcggagatgacttgcaa
caagatatgcttactctccagatggtaagaataatggataaattatggctcaaagaaggt
ttggatttaaaaatggtcacctttgcttgcgtgccaactggtaataaacgcggtatgatt
gaaatggtaacgaatgccgaaacactgagaaaaattcaagttgaatttggtctcacgggt
tcatttaaagacagacctattgctgaatggctcgcaaaacataatccgtctgaattagag
tacgagagagctgttgaaaattttacagcttcatgtgcgggttatagtgttgctacttac
attctaggaatttgcgatcgtcacaatgataacattatgcttaaaacatctggccacttg
tttcatattgactttggaaagtttttaggcgacgctcagatgtttggtaattttaaaagg
gatcgaactccattcgtattgacttcagatatggcgtacgtgatcaacggaggcgataaa
ccgtcggcgaaatttcataacttcgtcgatttgtgctgtcaagctttcaatattgtacgg
aaacatgggaatcttattcttcatttatttggtttgatgacgtcctctggtattcctgga
gttacaatggatgctgtgagttatgtacaaaaagctcttctaccaggacaaacaaatcct
gaggctgctgcaacgttcgcacgaatgattgaaagctctctgaaaaattggttcactcaa
tttaattttttcctccacaatttggcgcaattgaggttcactggtgatcacaacgacggt
gaacttttatcatttattccccgtacctacacgatgcagcaagaaggacaactaacaagt
gtccaagttcatggctaccaaaaacgctacgatccagaaaaatattacatgtacatttta
agaatacaaagaaagggtcaaccagatccaacttatttattccgctcgtacaaagaattt
tgcgaattctatcaaaaattatgcattcactttcctcttgccaaagttgccagcttaccg
agtggtatgagcgtgggccgatcaaacataaagcaagtggcagacaaacgtcgagcagat
atcgagaaatttttacttagtctatttaaaatggcacctgaaatatcacaaagtgacctt
gtttatacattttttcatccattattacgagatcaacagaatgctgatattcatcttcgt
aaagtaaaagtcggtaattggtgggctgaaaaaagagtcagagataatatccaatgtgga
caaataaaattatcattgcattacagccgtggtacattatcagtcatgattcatcatgct
cgaggtttgccaaaggttgcaaatgcccaagagccaaatacttatgtaaaagtatatttg
aaaccagaccctacaaaagccaccaaacgtaaaacaaaagttgtcaaaaaaaattgtcat
ccatcatttatggaaatgttagaatatagaatgccgctagaagttattaaagaacgtaca
ctagaagcgactatttggaatcatgatactctacaagaaaatgaatttctcggtggtatt
cgtttaccacttggtcattttgatttaaataatgaaactattgaatggtttcctctcggt
agtattcgatag

DBGET integrated database retrieval system