KEGG   Microplitis demolitor: 103570478Help
Entry
103570478         CDS       T05600                                 

Definition
(RefSeq) heat shock protein 68-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mdl  Microplitis demolitor
Pathway
mdl03040  Spliceosome
mdl04141  Protein processing in endoplasmic reticulum
mdl04144  Endocytosis
mdl04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103570478
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103570478
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103570478
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    103570478
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mdl01009]
    103570478
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mdl03041]
    103570478
   03009 Ribosome biogenesis [BR:mdl03009]
    103570478
   03110 Chaperones and folding catalysts [BR:mdl03110]
    103570478
   04131 Membrane trafficking [BR:mdl04131]
    103570478
   03051 Proteasome [BR:mdl03051]
    103570478
   03029 Mitochondrial biogenesis [BR:mdl03029]
    103570478
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdl04147]
    103570478
Protein phosphatases and associated proteins [BR:mdl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103570478
Spliceosome [BR:mdl03041]
 Complex B
  Other components
   Prp19 complex
    103570478
 Complex C
   Prp19-CDC5 complex
    103570478
Ribosome biogenesis [BR:mdl03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103570478
Chaperones and folding catalysts [BR:mdl03110]
 Heat shock proteins
  HSP70 / DNAK
   103570478
Membrane trafficking [BR:mdl04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103570478
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103570478
Proteasome [BR:mdl03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103570478
Mitochondrial biogenesis [BR:mdl03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103570478
Exosome [BR:mdl04147]
 Exosomal proteins
  Proteins found in most exosomes
   103570478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C StbA Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 103570478
NCBI-ProteinID: XP_008546462
Position
Unknown
AA seq 642 aa AA seqDB search
MPAIGIDLGTTYSCVGVWQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQIAMNP
TNTVFDAKRLIGRRFDDPKIQADIKHWPFKVINDNSKPKIQVEFKGERKVFSPEEISSMV
LTKMREIAEAYLGQQIREAVITVPAYFNDSQRQATKDAGSIAGLNVLRIINEPTAAALAY
GLDKNLSGEKNVLIFDLGGGTFDVSILTIDQGSLFEVKSTAGDTHLGGEDFDSRLVGHFV
QEFQRKYKKDLTVNPRALRRLRTAAERAKRTLSSSTEATLEIDALYEGLDFYTKISRARF
EELCADLFRKTLEPVEKALNDAKMDKKSIDDIVLVGGSTRIPKIQSLLQNFFNGKQLNLS
INPDEAVAYGAAVQAAILTGEGDKNSTLQDVLLVDVIPLSLGIETAGGVMTKLVERNSRI
PCKQTQTFTTYSDNQPAVTVQVFEGERAMTKDNNLLGTFELTGIAPAPRGVPKIEVTFDI
DANGILHVTAKDTASGRSRDVVIRNDKGRLSKAEIEKMLADAEKYKDDDNKQRETLAVKN
KLESYVYSVKQAAQEQGHNLSADDKNKVISLCDETVQWMDSNTLADKEEYQHKLETLQAQ
CSPIMTKLHQGQGQGQGQWQGQGQGQRKGQGQNDGPTIEEVD
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaattggaattgatttgggaactacgtacagttgcgtgggtgtttggcagcat
ggaaaagttgagatcatcgcgaatgatcaaggaaatagaacaacaccaagttacgtagca
ttcaccgacactgaacgtttgattggtgatgctgccaagaaccagatagccatgaatccc
accaacactgtttttgatgctaaacgattgatcggacggcgcttcgatgatcccaagata
caggctgatatcaagcactggccatttaaagtaataaatgacaacagtaagccgaaaatt
caggtcgagttcaagggcgagcgcaaggtatttagccctgaggaaataagttctatggta
cttaccaagatgagggaaattgctgaagcttacttgggacaacaaatacgtgaagctgtt
ataacagtaccagcttattttaatgattcacagagacaagccaccaaagatgctggatct
attgcgggccttaatgtcctgcgtattatcaatgaaccaactgctgcagctttagcttat
gggctagacaaaaatttaagtggtgaaaaaaatgtcctgatattcgatcttggcggcggt
acatttgacgtttctattttaacaattgatcaaggatcgttgtttgaagttaaatccact
gctggtgacacacatctaggtggagaagacttcgattcacgtttagttggtcattttgta
caagagttccaacgtaaatacaaaaaagatttgactgtcaatccacgtgcattaagacgt
cttagaacagcagctgaacgtgctaaacgtacgctgtcatccagcactgaagctactttg
gagatagacgctctgtatgaaggtctcgacttttatactaaaatttctcgcgctagattt
gaagaactctgtgcagatttattccgcaagacactggaaccagttgagaaggctttgaat
gacgctaaaatggataaaaaatcaattgatgacattgttctagtcggtgggtcaacgcgt
attcctaaaattcaatcattgcttcagaattttttcaacggaaagcaattgaacctttca
attaatcctgacgaagctgtggcctatggagcagcggtacaagcagctattttgaccggt
gaaggtgataaaaattcaacacttcaagatgtacttcttgttgatgtcattcctctgtca
ttgggtatcgaaacagcaggaggtgtgatgactaaactagttgaaagaaactctcgtata
ccctgtaaacaaactcaaacatttactacgtattcagataatcaaccggcagtaactgtt
caagtatttgaaggcgaacgagcaatgactaaagacaataatctactgggtacatttgaa
ttaacagggatagcaccggctccacgtggagtccctaaaatagaagttacttttgacatc
gatgctaatggaattcttcatgtaactgccaaagacacagcaagtggtcgtagtcgcgat
gtcgtaattagaaatgacaaaggcagactgagtaaggcggaaattgaaaaaatgcttgct
gatgctgaaaaatataaagatgatgataataaacaacgtgaaactcttgctgtaaaaaat
aaattagagagctatgtatactcagtcaaacaggctgctcaagaacaaggtcacaatttg
tctgctgatgacaagaataaagttattagtctgtgtgatgaaactgtccagtggatggat
agcaatactctggcagataaagaagaatatcagcacaaattagagacactccaagctcaa
tgctcccctataatgactaaattacatcaaggtcaaggtcagggtcagggtcaatggcaa
ggtcaaggtcaaggccaacgcaaaggacaaggacaaaacgatggacccaccattgaagaa
gttgattaa

DBGET integrated database retrieval system