KEGG   Microplitis demolitor: 103571039Help
Entry
103571039         CDS       T05600                                 

Definition
(RefSeq) erlin-2-B
  KO
K23341  erlin
Organism
mdl  Microplitis demolitor
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mdl04121]
    103571039
Ubiquitin system [BR:mdl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    103571039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 PIN_10
Motif
Other DBs
NCBI-GeneID: 103571039
NCBI-ProteinID: XP_008547233
Position
Unknown
AA seq 328 aa AA seqDB search
MLDQSVIGLCIIVGLAGVFNFSIHKIDEGHVGVYFRGGALLPQVSQPGFHMMVPLLTTFR
SVQVTLQTDEVKNVPCGTSGGVMIYFDRIEVVNILDSNAVYNMVRNFTADYDRTLIFNKV
HHELNQFCSIHTLHEVYIDLFDQIDENLKNALQKDLNELAPGLSIQAVRVTKPKIPETIR
KNYELMEGEKTKLLISTQHQKVVEKDAETDRKKALIEAEKESQVASIQYNQKIMEKESLQ
RMASIEDAMHLAREKSRSDADYYQMKRQAEANQILLTKEFLELKKYESLAKNAKIYYGQD
IPKMFAMGGCSNDPSLGTHTNVELDKND
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgttggatcaaagtgtcatcggtctttgcatcattgttgggctagcgggagtatttaat
ttttcaattcacaaaattgatgaaggtcatgttggtgtttactttcggggaggcgcatta
ttaccgcaagttagtcagccaggttttcatatgatggttccattgttgacgacatttagg
tctgtacaagtgactttacaaactgatgaagttaaaaacgttccttgtggtaccagtggc
ggtgtcatgatatatttcgatcgcattgaagttgttaatatactagattctaatgctgtg
tacaatatggtaagaaattttactgctgattatgacaggacgttgatcttcaataaagtc
caccatgaacttaatcagttctgttcaatccataccctccatgaagtgtacatcgattta
tttgatcaaattgatgagaacctgaagaacgcgctacagaaagatttaaatgaactggcg
ccaggtctcagtatccaagcggttcgtgtgaccaaacctaaaatacccgagacaatacga
aagaactacgagttgatggagggcgaaaagaccaagctgctgatatcaactcagcaccag
aaggtggttgaaaaagatgctgagactgatcgtaagaaagctctgattgaagctgagaaa
gagtcgcaagtcgcgtcgattcagtacaaccagaaaataatggagaaagaatctttgcaa
cgcatggcttcgattgaagacgcgatgcatttagctcgtgagaaaagtcgctcggatgct
gactattatcagatgaagcgacaagcggaagctaatcagatactccttactaaagagttc
ctggagctcaaaaaatatgaatccttagcgaagaacgcgaagatttactatggccaggac
attccgaagatgtttgccatgggcgggtgctctaatgatccaagtctaggcactcatact
aatgtagagcttgataaaaacgattga

DBGET integrated database retrieval system