KEGG   Microplitis demolitor: 103571176Help
Entry
103571176         CDS       T05600                                 

Definition
(RefSeq) cathepsin O
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
mdl  Microplitis demolitor
Pathway
mdl04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103571176
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mdl01002]
    103571176
Enzymes [BR:mdl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     103571176
Peptidases and inhibitors [BR:mdl01002]
 Cysteine peptidases
  Family C1: papain family
   103571176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 103571176
NCBI-ProteinID: XP_008547449
Position
Unknown
AA seq 361 aa AA seqDB search
MMEWRTVAVSVFMISLCFLVIPIRVPSSSSSNTIDDDIRLFESYIVRYNKSYRHDPIEYD
KRFKHFQISLRGIEKMNKLRTSKESAYFGATEYSDLSEDEFLKLALRKDISNRAERHRID
RFMRQKNYSPEGNLIRYERAIRIPPRLDWRTKGVVTPVKSQGNCGACWAYSTVECIESMI
AIKNHTLTSYSVQEMIDCAGNNNFGCEGGDICSLLSWLVDNQISILSESLYPVTGKTDTC
TLERSPKSSVRVTDFTCDSFVNAEEQLLDVLVNHGPVAAAVNALSWQNYLGGIIQFHCDS
SFKMLNHAVQIVGYDNTGKIPYYIVRNSWGPLFGNDGYLYIAIGNNLCGIANQVSSLNAI
W
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgatggagtggagaacggtagcggtatctgtgtttatgataagtctttgctttctggtt
attcctataagagtaccgtcatcgtcatcatcaaacactattgatgatgacatacgatta
tttgagagttacattgtgcgttacaataaatcttatcgtcatgatccgatcgagtatgac
aagagattcaaacattttcaaatttctcttcgaggtatagagaaaatgaataagttaaga
acgtcgaaggagagcgcgtattttggagcgacagagtattcagatttatcggaagatgaa
tttttaaagctggcattacgtaaagacatatcgaatcgtgctgagagacatcgaattgac
cgttttatgcgtcaaaagaattacagtcctgagggtaatttaatacggtacgagagagcg
ataagaataccgccgagactcgactggaggacaaagggagttgttacaccggttaaaagc
caagggaattgtggggcttgttgggcttacagtactgttgaatgtattgaatcaatgatt
gctattaaaaatcatacacttacatcttacagtgtccaggagatgattgattgtgccggt
aacaataattttggctgtgaaggtggagatatttgtagtctattatcatggctggtagat
aatcaaatatcaatcttgtcagaatctctttatccagtaactgggaaaacagatacttgt
acattagaacgatcaccaaagtcatcagttcgagttactgatttcacatgtgatagtttt
gtaaatgctgaagaacaactgctggatgttttggttaatcatggaccagtagcagcagca
gtaaatgctctttcctggcaaaattatttaggcggaataattcaatttcactgcgacagt
tcatttaaaatgttaaatcatgcagtacaaatagtaggttacgataatactggaaaaata
ccttattatatcgttagaaattcatggggaccgttgtttggtaatgatggatatctttat
attgctattggaaataatttatgtggaatagcaaatcaagtgtcatcattaaatgctatc
tggtag

DBGET integrated database retrieval system