KEGG   Microplitis demolitor: 103572015Help
Entry
103572015         CDS       T05600                                 

Definition
(RefSeq) heat shock protein 68-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mdl  Microplitis demolitor
Pathway
mdl03040  Spliceosome
mdl04141  Protein processing in endoplasmic reticulum
mdl04144  Endocytosis
mdl04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103572015
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103572015
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103572015
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    103572015
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mdl01009]
    103572015
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mdl03041]
    103572015
   03009 Ribosome biogenesis [BR:mdl03009]
    103572015
   03110 Chaperones and folding catalysts [BR:mdl03110]
    103572015
   04131 Membrane trafficking [BR:mdl04131]
    103572015
   03051 Proteasome [BR:mdl03051]
    103572015
   03029 Mitochondrial biogenesis [BR:mdl03029]
    103572015
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdl04147]
    103572015
Protein phosphatases and associated proteins [BR:mdl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103572015
Spliceosome [BR:mdl03041]
 Complex B
  Other components
   Prp19 complex
    103572015
 Complex C
   Prp19-CDC5 complex
    103572015
Ribosome biogenesis [BR:mdl03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103572015
Chaperones and folding catalysts [BR:mdl03110]
 Heat shock proteins
  HSP70 / DNAK
   103572015
Membrane trafficking [BR:mdl04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103572015
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103572015
Proteasome [BR:mdl03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103572015
Mitochondrial biogenesis [BR:mdl03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103572015
Exosome [BR:mdl04147]
 Exosomal proteins
  Proteins found in most exosomes
   103572015
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A StbA FGGY_C
Motif
Other DBs
NCBI-GeneID: 103572015
NCBI-ProteinID: XP_008548619
Position
Unknown
AA seq 638 aa AA seqDB search
MPAIGIDLGTTYSCVGVWQQGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNP
ANTVFDAKRLIGRKFDDPKVQSDIKHWPFKVINEGGKPKIQVEFRGEVKKFNPEEISSMV
LTKMKEIAEAYLGQKVKDVVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAALAY
GLDKNLKGEKNVLIFDLGGGTFDVSILSIDEGSLFEVKSTAGDTHLGGEDFDSRLVDHLC
KEFERKYKKDLKTNPRALRRLRTAAERAKRTLSSSTEATIEIDALFDGIDFYTKVSRARF
EELCADLFRSTLEPVEKALADAKLDKKSIDDVVLVGGSTRIPKIQSMLQNFFCGKQLNLS
INPDEAVAYGAAVQAAILTGEGGKTSTLQDVLLVDVAPLSLGIETAGGMMTNIIERNARI
PCKQTQTFTTYADNQPAVTIQVYEGERAMTKDNNLLGKFELSGIAPAPRGVPKIDVTFDL
DANGILHVTAKDTASGRSSDVRITNDKGRLSREEIDRMLAEAERYRDQDKQQRDKVAARN
QLETYAFSVKQAIQDSGSRLSQSEKDQVTQLCEETIYWLDNNTLAEQDEYKHKLDELQKQ
CSPIMTKLHQGGNPAGAQNYGAQHRPDSNSGPTVEEVD
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccattggtattgatcttggaaccacatactcttgtgttggagtatggcaacaa
ggaaaagttgaaatcatcgccaacgatcaaggcaatagaacaacacctagttatgttgct
ttcacggacaccgagcgtctcattggagacgcagctaagaaccaggttgcgatgaatcca
gcaaacacagtcttcgacgccaagcgactcatcggcagaaaattcgacgacccaaaagtt
caaagtgacataaagcactggcctttcaaggtaatcaacgagggaggaaagcctaaaatc
caagtcgagttccgcggtgaagtaaagaaattcaatccagaagagataagttcgatggtc
cttacgaaaatgaaagagattgctgaggcttaccttggacagaaagttaaggacgtggtc
atcacagtaccagcatatttcaacgattcacaacgtcaagctaccaaagacgcgggtgcc
attgctgggctgaatgttcttaggatcatcaacgagccaacagccgctgctctagcttat
ggtctagacaagaacctgaaaggtgagaaaaatgtgcttatctttgacctcggtggtggt
acttttgacgtttccatcctgtcgatcgatgagggctcactattcgaggtcaaatcaact
gccggtgatacacatcttggaggagaagacttcgattcacggttggtggaccatttgtgc
aaagagtttgaaagaaaatacaagaaggatcttaagaccaatccacgagcgttaagaaga
ttgagaacagctgcagaacgtgccaagcgtacactatcatctagtaccgaagcaaccatc
gaaattgatgctctattcgatggtattgatttctacaccaaagtctcaagggcacgtttc
gaagaactctgcgctgatcttttcagatccacattggaacctgtggaaaaagcactagca
gacgccaagctcgacaaaaaatctatcgatgacgttgttctcgttggtggttccactcgc
atcccaaaaatccaatcgatgctccagaatttcttctgtggaaagcaactcaatctatct
atcaaccccgacgaggccgtggcttacggcgcagcggtgcaagcagctatcttaaccggt
gagggtggcaagacctcaaccctccaggatgttcttcttgtggacgtcgctccgttatct
ctgggtattgagactgcaggtggtatgatgaccaacatcattgaacgcaatgctcgtata
ccctgcaaacagacccagacattcacaacttatgccgacaaccaacccgccgtgaccatc
caggtctacgaaggcgagcgagcaatgaccaaggacaacaacttgcttggtaaattcgag
ctcagtggaatagcacctgctccacgtggtgtaccgaagatcgatgtcaccttcgacttg
gacgccaacggaatcctgcatgtgacagccaaggacacggcaagtggtcgtagcagtgat
gtccgaattaccaacgacaaaggacgtctatcacgggaagagatcgaccgcatgcttgct
gaagctgaacgttaccgcgatcaagacaaacaacagcgagacaaagtcgcagcacgcaac
caacttgagacctacgcattctcggttaaacaagcaatccaggacagcggatcccgtttg
agtcagtccgaaaaagaccaagtcactcaattatgcgaagaaaccatctattggctagac
aacaataccttagctgagcaggatgaatacaagcataaactggacgagcttcagaagcag
tgctcacctatcatgaccaaactccatcaaggcggtaaccctgcgggtgctcagaattac
ggagcccaacatcgtccggacagcaactctggcccaactgttgaagaagttgactaa

DBGET integrated database retrieval system