KEGG   Microplitis demolitor: 103572052Help
Entry
103572052         CDS       T05600                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK4
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
mdl  Microplitis demolitor
Pathway
mdl04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103572052
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdl01001]
    103572052
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mdl03036]
    103572052
Enzymes [BR:mdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     103572052
Protein kinases [BR:mdl01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   103572052
Chromosome and associated proteins [BR:mdl03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103572052
   Centrosome duplication proteins
    Regulators of centriole replication
     103572052
  Sister chromatid separation proteins
   Polo kinases
    103572052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Plk4_PB1 Plk4_PB2 Pkinase_fungal Kinase-like APH FTA2 RIO1
Motif
Other DBs
NCBI-GeneID: 103572052
NCBI-ProteinID: XP_008548665
Position
Unknown
AA seq 769 aa AA seqDB search
MPPLSKGFGEHIEDYKVLEFLGKGGFGCVYKAKCLNTRIDVAIKMIDKNLMQRHGMIGRV
RDEVAIHSRLKHQSILKLYTYFEDANYVYMVLELCPNGDLQRFLKEHYPQGLSEDEAARV
IKQVLEGLLYLHNHKILHRDMSPSNLLLTADMQVKIADFGLATLSKPNENHMTLCGTPNY
ISPEVATRSSHGPQADVWGLGCLLYTLLVGKAPFDTDGVKSTLTRVVMADYTIPSYLSDK
AKDLISRLLKKNPHDRIELRDILKHPFITSNDQKFQEKVLLSRALSRDRMADSGLGKTMS
SVDRMPRGRSRSEERASMVPSMSTPLAPQFTVRSDPLTERNNYQNNFAYQSKRNDYSREQ
ASVLSGIPPPRSRVFSRTSQNSCEDINRQKNDKQRCREQAVESLKDQDVNTKLQIPPLNS
QRLLPARHRTKNAVLTILDSGEVCIEFIKKKNSNMERIGEVCRISSDGLRIVIYKLKEST
PIGDEPPPLPSYGADNIYSYESLPSRHHRKYIYAARFVKLVKAKTPKVTLYTERAKCQFM
ENGPHPDCELHFYNGIKIVCVDGVVKTTDSSGNSYGEGEVPHELEEYYEHYRECYKRCLL
LETTLTSLESATGHSYFPAIIGRKPLSAGSIPSLQGKENVSRMTNSPPVMPSFDATCSVM
SAVTSRSKKTNSVRSSQYAFNRVIIPGIGVAIQLPNGDVKIEYKDGSAITVRPDSRGGGV
LYENDNGAITKYSKNHHQNVQMPYEVKEKLRHLPTVITHLVQPRHRNIR
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgttatccaaaggattcggcgagcatatcgaggattacaaagtacttgaattt
ttgggtaagggtggatttggatgtgtttataaagcaaaatgtttaaatacaagaatagac
gtagcgatcaaaatgatcgacaaaaatttaatgcaacgccatggaatgattggcagagta
cgtgatgaagtagctattcattcacgattaaaacatcagtctattttaaagctttataca
tattttgaagacgctaattatgtttatatggtactagaattgtgtcctaatggagattta
caacgttttttaaaagaacattatcctcaagggctatcagaagatgaagctgccagagtt
ataaaacaagtattagagggattgctttatttacataatcataaaatactccacagggac
atgtctccttctaatttattattgactgcagacatgcaagtgaaaatagctgactttgga
ctcgcgacattatcaaaacctaatgaaaatcatatgactttatgtggtacacctaattac
atttcacctgaagttgcgacaagatcatcacatggtccacaagctgacgtatggggttta
ggatgtttgttgtacactttattagtaggcaaagctccatttgatactgatggtgtaaaa
agtactttgactcgtgttgttatggctgattatactataccatcttatttatctgacaaa
gcaaaagatttaataagtcgtttattaaaaaaaaatccacatgatagaattgaattgcgc
gatattttaaagcatccatttattacatccaatgatcaaaaattccaggaaaaagtttta
ttgagcagagcattatcgcgagatagaatggctgattcaggattaggtaaaacaatgtct
tcagttgatcgaatgcctcgaggccgctctcgttcagaagagcgtgcttcgatggtgcca
tcaatgtctactccattagctccacagtttactgtcagaagtgatcctttaactgagaga
aacaactatcagaataacttcgcttatcaaagtaagcgaaatgattattctcgagagcag
gcatctgtactttcaggcataccaccacctcgtagtagagtattttcacgaacttcccaa
aatagctgtgaagacattaatcgtcagaaaaatgataaacagagatgtcgggagcaagct
gttgaaagtcttaaagatcaagatgttaacacaaaattacaaattccaccgttgaattct
caaagacttttgccggcaagacatcgtacgaaaaatgctgttcttacaattctagatagt
ggagaagtgtgtattgagtttataaagaaaaagaatagtaatatggaacgcattggggaa
gtttgtagaatatcaagtgatggtttgcgaatcgttatatataaattaaaagaatctaca
ccaattggtgatgaaccacctccattaccttcttatggcgctgataacatttattcatat
gaaagtttaccgtctcgacatcataggaaatatatttatgctgcaagatttgttaaactt
gttaaagcaaaaacacctaaagtaacattatacactgaacgtgctaaatgtcaatttatg
gaaaatggaccacatccagattgtgaattacatttttacaatggtattaaaatagtttgt
gttgacggtgtcgtaaaaacaacagattcaagtggcaatagttatggagaaggagaagta
ccacatgaattggaagaatattatgaacattacagagaatgttataaacgttgtttactt
cttgaaacaacattaacttcattagaatctgctacaggtcattcatactttccagcaatt
attggacggaaacctctgtctgctggaagtattccttctttgcaaggaaaagaaaatgta
tcacgaatgacaaacagcccacctgtgatgccttcgtttgatgccacttgttcggtaatg
tctgcagtaacatcaagatctaaaaaaacaaattctgttcgttcatcacagtatgcattt
aatagagttattattcccggaattggagtagcaattcaattaccgaatggagatgttaaa
atagagtataaagatggatctgcaataacagttcgtccagatagtcgtggtggtggagta
ttatacgaaaacgataatggtgcgattaccaaatattctaaaaatcatcatcaaaatgtt
caaatgccttatgaagtgaaggaaaaattacgacatttacctacagtcattactcattta
gtacaaccgaggcatcggaatataagatga

DBGET integrated database retrieval system