KEGG   Microplitis demolitor: 103572586Help
Entry
103572586         CDS       T05600                                 

Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mdl  Microplitis demolitor
Pathway
mdl00450  Selenocompound metabolism
mdl00970  Aminoacyl-tRNA biosynthesis
mdl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    103572586
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103572586
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mdl01007]
    103572586
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mdl03016]
    103572586
Enzymes [BR:mdl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     103572586
Amino acid related enzymes [BR:mdl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   103572586
Transfer RNA biogenesis [BR:mdl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    103572586
 Prokaryotic type
   Other AARSs
    103572586
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-GeneID: 103572586
NCBI-ProteinID: XP_008549451
Position
Unknown
AA seq 502 aa AA seqDB search
MIKGPHIGHLYTAALADALNRYNIMLGHQVFLSTGTDEHGTKVRDSAIANNLSPQIYTDK
ISGLFKEMCDNFDIGYSNFIRTTDKRHHEAVNHFWTTLEDSGHLYLGKYSGWYCISDEAF
VPESELEEKKLLNGDTIKVSASSGNKVQWMEEENYKFKLSSMQDDLKYWLKNVKVVQPLK
FHKILSCWIEEGSCLEDLSVSRPTSRAPWGIKVPNDNSHTIYVWLDALVSYLTSLGYPKN
PEFAKFWPPTIQVIGKDILKFHGVYWPAFSMATGLDPPTTLLCHSHWTINDEKMSKSKGN
VVSPSEAAKLFTADGLRYFLLREAVPYSDAKLANTLGNLVSRCMGKAVNPDKIIPEPCKS
HSDILNSNEALKLVESLESVTLAAQNHYNDFNLHHVVNVVMQTLFAANKMIDYHKPWALA
KETDNLEAQQKLKAVLALGLESARVGSLILMPIIPRLTCHLLDFLNVPYNSRTWNNSKYL
NTGRNDTIMPKQQDFSFFQKIR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaggaccacatattggacatctttatacggctgctcttgctgatgcattaaat
cgttacaatattatgttgggacatcaagtatttctaagtactggcactgatgaacatggt
actaaagttcgtgattctgcaatagctaataatttatcaccacaaatatatacggacaaa
atatctggattatttaaagagatgtgtgataattttgatattggttattcaaattttata
cgaactactgacaaaaggcatcatgaggctgttaatcatttttggacgacacttgaagac
agtggacatttatatttaggaaaatattcaggatggtattgcatatcagacgaagcattt
gttccagaatcagaattagaggaaaaaaaattgttaaatggtgatactattaaagtttca
gcgtcatctggtaataaagttcaatggatggaagaagaaaattataaatttaaattaagt
tcaatgcaagatgatttaaagtactggttaaaaaatgttaaagtcgttcaacctttaaaa
tttcataaaattttgagttgttggattgaagaaggaagttgtttagaagatttaagtgtc
tcacgaccaacatcacgagcaccctggggtattaaagtacctaatgataattctcatact
atttatgtatggctagatgctttagttagttatttaacatcacttggatatcctaaaaat
cctgaatttgctaaattttggccaccaactattcaagttataggaaaggatattttaaaa
tttcatggtgtgtattggcctgcattcagtatggctactggtctagatccaccgacaact
ctattgtgtcactcacactggactattaatgatgaaaaaatgtcgaaatctaaaggaaat
gtcgtatctccatcagaagctgctaaattatttaccgcagacggcttaagatattttctt
ttacgtgaagcagtaccatacagtgacgcaaaattagctaatacattgggaaatttagta
agtagatgtatgggaaaagcagtaaatccagataaaataattcccgagccttgtaagagt
cattcagatatattaaattctaatgaagcactcaaactagtagagagtcttgaatctgta
actctggctgctcaaaatcattataatgattttaatttgcatcatgttgttaatgtcgtg
atgcaaacactatttgcagcaaacaaaatgattgattaccacaaaccttgggcattagct
aaagaaactgataatttagaagctcaacagaaactaaaagccgtattagcacttggtctt
gaatctgctagagtgggttcattaattcttatgccaattattccgagattaacttgtcac
cttcttgactttctcaatgtaccttataattcacgtacctggaataactccaagtattta
aatactggtcgtaatgatactattatgcccaagcaacaagacttttcattctttcaaaaa
atacgataa

DBGET integrated database retrieval system