KEGG   Microplitis demolitor: 103573832Help
Entry
103573832         CDS       T05600                                 

Definition
(RefSeq) heat shock 70 kDa protein cognate 4
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mdl  Microplitis demolitor
Pathway
mdl03040  Spliceosome
mdl04141  Protein processing in endoplasmic reticulum
mdl04144  Endocytosis
mdl04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103573832
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103573832
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103573832
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    103573832
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mdl01009]
    103573832
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mdl03041]
    103573832
   03009 Ribosome biogenesis [BR:mdl03009]
    103573832
   03110 Chaperones and folding catalysts [BR:mdl03110]
    103573832
   04131 Membrane trafficking [BR:mdl04131]
    103573832
   03051 Proteasome [BR:mdl03051]
    103573832
   03029 Mitochondrial biogenesis [BR:mdl03029]
    103573832
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdl04147]
    103573832
Protein phosphatases and associated proteins [BR:mdl01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103573832
Spliceosome [BR:mdl03041]
 Complex B
  Other components
   Prp19 complex
    103573832
 Complex C
   Prp19-CDC5 complex
    103573832
Ribosome biogenesis [BR:mdl03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103573832
Chaperones and folding catalysts [BR:mdl03110]
 Heat shock proteins
  HSP70 / DNAK
   103573832
Membrane trafficking [BR:mdl04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103573832
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103573832
Proteasome [BR:mdl03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103573832
Mitochondrial biogenesis [BR:mdl03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103573832
Exosome [BR:mdl04147]
 Exosomal proteins
  Proteins found in most exosomes
   103573832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 103573832
NCBI-ProteinID: XP_008551290
Position
Unknown
AA seq 653 aa AA seqDB search
MTTKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPNNTIFDAKRLIGRRFDDATVQADMKHWPFNVVSDAGKPKIQVQYKGETKTFFPEEV
SSMVLVKMKETAEAYLGQTVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAA
AIAYGLDKKATGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVN
HFVQEFKRKYKKDLTSNKRALRRLRTACERAKRTLSSSTQANIEIDSLFEGIDFYTSITR
ARFEELCADLFRSTLEPVEKSLRDAKIDKSVIHDIVLVGGSTRIPKIQKLLQDFFNGKEL
NKSINPDEAVAYGAAVQAAILHGDKSEAVQDLLLLDVTPLSLGIETAGGVMTALIKRNTT
IPTKQTQTFTTYADNQPGVLIQVYEGERAMTKDNNLLGKFELSGIPPAPRGVPQIEVTFD
IDANGILNVSAADKMSGKENKITITNDKGRLSKEEIERMVNEAEKYKNEDEKQKETISSK
NGLESYCFNMKSTVEDEKLKDKISAADKQTVLDKCNEIIKWLDANQLAEKEEYEHKQKEL
ENICNPIVTKLYQGAGGMPGGMPGGMPGGMPGAGAAPGGAPGAGSGPTIEEVD
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgactactaaagcacccgcagttggtattgatttgggaacgacttactcctgtgtcgga
gttttccaacatggaaaggttgaaataatcgccaatgaccaaggaaaccgaacaacacct
agttatgtcgcattcactgacaccgaacgacttatcggcgatgccgctaaaaaccaggtc
gccatgaaccccaacaacaccatctttgatgctaaaagactgataggacgtcgttttgat
gacgcaactgttcaagctgatatgaaacattggccattcaacgttgttagtgacgctgga
aagccaaaaattcaagttcagtacaaaggcgagacaaagactttcttccctgaagaagtg
agctccatggtattagtaaaaatgaaggaaacagctgaagcataccttggtcagactgtc
agcaatgctgtaattactgtacctgcttactttaacgactcgcagcgtcaggcaaccaag
gacgctggaactatttcaggcttgaacgttttacgtattattaacgagccaactgccgcc
gccattgcttacggtttggacaagaaagcaactggagagcgtaacgttttaatctttgac
ttgggtggtggtacctttgatgtctccattcttaccattgaagacggtatctttgaagtt
aaatctactgctggagatactcatcttggtggagaagattttgacaatcgtatggttaat
cactttgtccaagaatttaaacgcaagtacaaaaaagatcttaccagcaacaagcgagct
cttcgtcgtctccgaactgcatgcgagcgtgcaaagagaactctctcttcatcaactcaa
gccaacattgaaatcgattcactcttcgagggaatcgatttctacacgtccatcacacgt
gcgagattcgaagaactttgtgctgatttattccgtagcactcttgagcctgtagagaaa
tctctccgtgatgctaagattgacaagtctgttatccacgacatcgtccttgttggtgga
tctacccgtattccaaagatccaaaaactccttcaagatttcttcaacggtaaggaactc
aacaaatctattaaccctgacgaagccgtcgcttatggtgcagccgtccaagcagctatc
cttcatggtgataaatctgaagctgttcaagaccttcttttgctcgatgttacaccattg
tcacttggtattgagacagctggtggtgtcatgactgctttgattaagcgaaacacaacc
attccaactaagcagacacagacctttacaacttatgctgataatcaacctggagtactc
attcaagtttacgaaggagaacgtgctatgaccaaggacaacaaccttcttggaaaattc
gagctctctggcattccaccagcaccacgtggagttcctcaaattgaggttacttttgat
attgacgcgaacggtattcttaatgtatcagctgccgacaagatgtcaggtaaagaaaac
aagatcaccatcaccaacgacaagggtcgtcttagcaaagaagaaattgaaaggatggtc
aacgaagctgaaaaatacaaaaatgaagatgagaaacaaaaagaaacaatttcatcaaag
aacggtcttgaatcttattgcttcaacatgaagagcacagttgaagatgagaaactcaaa
gataagatcagcgcagccgacaaacaaactgtactcgacaaatgtaatgagatcatcaaa
tggcttgatgcaaaccaacttgctgagaaagaagagtacgaacacaagcaaaaagaactt
gaaaacatctgcaatcctattgtgacgaaactttaccaaggagctggcggtatgcctggt
ggtatgcccggtggtatgcctggaggtatgccaggagctggagccgcaccaggtggtgca
cctggagcaggatctggaccaaccatcgaagaagttgattaa

DBGET integrated database retrieval system