KEGG   Microplitis demolitor: 103574233Help
Entry
103574233         CDS       T05600                                 

Definition
(RefSeq) histidine decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
mdl  Microplitis demolitor
Pathway
mdl00340  Histidine metabolism
mdl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    103574233
Enzymes [BR:mdl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     103574233
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 103574233
NCBI-ProteinID: XP_014297826
Position
Unknown
AA seq 683 aa AA seqDB search
MVDYIANYLETIRTRRVYPAVSPGYLRNILPISAPVEGEPWENIFEDIEKCIMPGVTHWQ
SPYMHAYFPALNCPASLLADMLADAINCLGFTWASSPVCTELETIVMNWLGKMIGLPEDF
LHCPGGSGGGVIQTTSSESTLVCLLAARTRAIRAIQEDEPDKSPGEINSHLVAYCSDQAH
SSVEKAGLIGLVQMRYIESDDKLSMRGDMLIEAIARDREAGLVPFFVCATLGTTGACSFD
NLCEIGPICEKNCIWLHIDAAYAGSAFVCPEFRGWLRGVEFADSIAFNPSKWLMVHFDCT
AMWVKNSQALHRTFNVDPLYLKHENSGLAIDYMHWQIPLSKRFRALKLWFVIRNYGITGL
QKHIREGVRLAQKFEALVLGDSRFEIPAARHLGMVVFRLRGENSLTERLLKKMNSTGRVH
CVPASLHGKYVIRFTVTSTNTTNEDILRDWAEIKTTASEILSSATVSPARVKVSLAETRQ
KNENFGSSLLLANSPMSPKIVNGSFAAIYDTADVFNDCMKTFGQLRLEPRDSPAMRRRIR
GILMSGKQFSLDSRMDLVQGYASCGRPLSEPNTTLPLMKEDEDYNGKNDSNLSIDKTDKS
IDIYYDNFTSKSNSDDSIDVNHHQVSFKTNIDNSIKMLEINEFFVEKPITKSETIGGISG
LINTTLTTQSHSDEMMNNKDCKK
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggtggattacatagctaattaccttgaaacaattcgaacaagacgagtttatccggct
gtatcacctggatacttgagaaatattttaccaatatcagctccagttgaaggtgaacca
tgggaaaatatttttgaggatattgaaaaatgtattatgcctggggtaactcattggcaa
agtccttatatgcatgcatattttccggcacttaactgtccagctagcttgttagcagac
atgttagctgacgctattaattgtcttggatttacttgggcatcaagtccagtttgtaca
gaattagaaacgattgtaatgaattggcttggaaaaatgattggattgcctgaagatttt
ttacattgtccgggtggatcaggtggtggagtaatacaaacaacttcctcggaatcaact
ttggtttgtcttttagctgctagaacacgagctatacgtgctatccaagaggatgagccc
gataagtcaccaggagaaattaattctcatctggttgcttattgttcggatcaggcacat
tctagtgtagaaaaagccggacttattgggctagtacaaatgcgatatatcgaatcagat
gataaattaagtatgagaggagacatgttaatagaagctatcgcacgggatcgtgaagct
ggactggtgccattctttgtatgcgcaactcttggtacaactggcgcatgttcttttgat
aatctgtgcgaaattgggccgatttgtgaaaaaaattgcatttggttacacatcgacgct
gcttatgcaggaagtgcttttgtctgtcctgagtttcgtggatggttacgaggtgtcgaa
tttgctgattcaattgcatttaatccaagcaaatggttgatggttcactttgattgtaca
gcgatgtgggtaaaaaatagtcaagcacttcataggacatttaatgttgatcctttatac
ttaaaacatgaaaattctggacttgcgattgattatatgcattggcaaattccattatca
aaaagattccgtgctcttaaactttggtttgtaatcagaaattacggaataactggatta
caaaaacatatccgtgaaggcgttcgtttagctcaaaaatttgaagctctagtattgggt
gactcgagatttgaaattccagcagcaaggcatcttggcatggttgtttttcgtcttcgt
ggagagaattcattaacagagagactgcttaaaaaaatgaatagtactggcagagttcac
tgtgttcctgcttcattgcatggaaaatacgtcatacgtttcactgttacttcaaccaat
acaacaaatgaagacattttacgtgattgggctgaaattaaaactactgcttctgagatt
ttatcatcagctactgtatcaccggctagagttaaagtttctcttgcagaaacgcgtcaa
aaaaatgaaaattttggatcaagtttattgcttgctaattccccaatgtcaccaaaaata
gttaatggtagttttgcagcaatatatgacacagctgacgtttttaatgactgtatgaag
acatttggacaactacgtttagagccacgtgatagtccagcaatgcgacgtcgtatccgt
ggtattttaatgtcaggtaaacaattttcactagattcacgaatggacttagttcaggga
tatgcgtcttgtggacgtcctttgtcggaacctaatacaacactaccgttaatgaaagaa
gatgaagattataatggaaaaaatgattcaaatctcagtatcgacaaaactgataaatct
atcgatatttattacgataactttacatcgaaatcaaattccgacgactcgattgacgtt
aatcatcatcaggtgagttttaaaacaaacatcgacaattctatcaagatgttggagata
aatgaattttttgtggagaaacctattacaaaaagcgaaaccattggtggaataagtggt
ttaatcaacactacacttacaactcaatcacattcagatgaaatgatgaataataaggat
tgcaaaaaataa

DBGET integrated database retrieval system