KEGG   Microplitis demolitor: 103574643Help
Entry
103574643         CDS       T05600                                 

Definition
(RefSeq) fructose-bisphosphate aldolase
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
mdl  Microplitis demolitor
Pathway
mdl00010  Glycolysis / Gluconeogenesis
mdl00030  Pentose phosphate pathway
mdl00051  Fructose and mannose metabolism
mdl01100  Metabolic pathways
mdl01200  Carbon metabolism
mdl01230  Biosynthesis of amino acids
Module
mdl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mdl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103574643
   00030 Pentose phosphate pathway
    103574643
   00051 Fructose and mannose metabolism
    103574643
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mdl04131]
    103574643
   03036 Chromosome and associated proteins [BR:mdl03036]
    103574643
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdl04147]
    103574643
Enzymes [BR:mdl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     103574643
Membrane trafficking [BR:mdl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    103574643
Chromosome and associated proteins [BR:mdl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103574643
Exosome [BR:mdl04147]
 Exosomal proteins
  Proteins found in most exosomes
   103574643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 103574643
NCBI-ProteinID: XP_014295027
Position
Unknown
AA seq 366 aa AA seqDB search
MSAEKYAKADPELKAELKKIAESIVAPGKGILAADESTTTIGKRLQDINVENNEENRKAY
RQLLFTTNKDVIKEHISGVILFHETLYQKADDGTPFVELMKERNIIPGIKVDKGVVPLFG
TDDECTTQGLDDLQARCIQYKKDGCHFAKWRCVLKIKGNTCPSRLAILENANVLARYASI
CQSARIVPIVEPEILPDGDHDLARCQQVTEEVLAAVYKALNDHHVYLEGTLLKPNMVTPG
QSCPKRATPQEIASATVIALQRTVPPAVPGITFLSGGQSEEEASVNLDAINKYPGKKPWA
LTFSYGRALQASVLRAWSGKKEQVAAGQEELIKRAKANSEASLGKYAGGVSGAAGDSALF
VPNHAY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctgaaaagtacgcaaaggcagacccagaattgaaggcagagcttaaaaaaata
gcagagtctattgtagcacctggtaagggtattttagcagctgatgaatcaacaacaact
attggtaaacgtttgcaagacataaatgttgaaaataatgaagagaaccgtaaggcttat
cgccaattgttgtttacaaccaacaaggatgtcattaaagagcatatctccggtgtaatt
cttttccacgagactttatatcaaaaagctgatgatggaacaccattcgtagaattaatg
aaagagcgcaacatcatccccggtatcaaagtagacaaaggtgttgtcccattatttgga
acagatgacgagtgcacaactcagggtcttgatgatctccaggctcgttgcatccagtac
aaaaaagacgggtgtcattttgctaaatggcgttgcgtgttgaaaataaaaggcaacacg
tgtccaagtcggttggccattttggagaacgctaatgtcttggcgcgctacgcatccatt
tgccagagcgcacggatcgtaccaatcgttgagcctgaaattttaccagacggtgatcat
gatcttgctcgttgccaacaagtcactgaggaagtactcgctgcggtatacaaggcactc
aatgaccatcacgtttacttggagggaactctcttgaaaccgaatatggtcactcctgga
cagagctgccccaagcgggcgacaccacaggaaatagcatcggcaacagtcattgccttg
caacgcacagtcccaccagcggtgcctggtatcactttcttgagtggtggtcagtctgaa
gaagaggcttcagttaatctcgacgccatcaataagtatccgggtaaaaaaccatgggct
ttgacattcagttacggcagagctcttcaagcttcggttttgagagcctggtctggtaag
aaggaacaggttgcagctggacaagaagaacttatcaagcgtgccaaggcaaatagcgaa
gcttcacttggaaaatatgccggtggtgtctctggagctgctggtgactctgcattattt
gttcctaatcacgcatattaa

DBGET integrated database retrieval system