KEGG   Microplitis demolitor: 103575130Help
Entry
103575130         CDS       T05600                                 

Definition
(RefSeq) serine/threonine-protein kinase polo
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
mdl  Microplitis demolitor
Pathway
mdl04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103575130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdl01001]
    103575130
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mdl03036]
    103575130
Enzymes [BR:mdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     103575130
Protein kinases [BR:mdl01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   103575130
Chromosome and associated proteins [BR:mdl03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     103575130
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103575130
  Sister chromatid separation proteins
   Polo kinases
    103575130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 103575130
NCBI-ProteinID: XP_008553005
Position
Unknown
AA seq 573 aa AA seqDB search
MSKDEKESIIPDVIYDETGGKSYLKGRFFGKGGFAKCYEIRESKSQNVYAGKIVSKSMMT
KSNHREKMTQEIQIHKSLNHKNIVGFYGFFDDCYNVYIILELCRKRSMMELHKRRKALTE
CETRYFMKQILDGVYYLHKNKIIHRDLKLGNLFLNDELQVKIGDFGLATKLSHDGERKKT
LCGTPNYIAPEILTKAGHSYEVDVWSIGCIMYTLLVGKPPFETSSLRETYARIKTVNYKT
PSNISSTAISMITNTLQGNPTKRPSVMKLLKDPFFTSGYMPRSLPLSCLTMAPRLDTLES
HNRKPLSEMNQNEEDEKAVFRIPTSPAPRAGTKTPESQTDAQKSGRNIKRMLITLKEQVT
AVLAAKPGRTDASLAVENTDPSAQPLVWVSKWVDYSDKYGFGYQLCDDGVGVMYNDGTRL
IMLANKFNIHYISRDLTETYYTVKDYPESLEKKMKLMTFFLQYMNEHLMKAGGSVAVKND
AMSRVPYMHQWFRTQTAVVMQLNNGTVQINFLDHSKIIMCPLMAAVTYIDQEKNFRTYRF
ETIQSNGCSAGLARNLEYALEKLELMIANSRQN
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagatgaaaaagagtctattattcctgatgttatttacgatgagactgggggc
aaaagctacctcaagggccgcttctttggaaaaggtggttttgctaaatgttacgagata
cgtgaatctaaatcacaaaatgtgtatgctggtaaaatagtatcaaagtcaatgatgact
aaaagtaatcatcgtgaaaaaatgacacaggaaatccaaattcacaaaagtttaaatcac
aaaaatatcgttggtttttatggtttttttgatgattgttataacgtctatattatatta
gaattatgtcgtaaaagatcaatgatggaattgcacaaacgtagaaaagcactaacagaa
tgtgaaactcgttattttatgaaacaaatattagacggagtttattatttacataaaaat
aaaataatccatcgtgatttaaaattaggtaatttatttttgaatgatgaattgcaagtt
aaaattggtgattttggattggcaactaaattatcacatgatggtgagcgtaaaaaaaca
ctatgcggtacaccaaattatatagcacctgaaatattaacaaaagccggtcattcatat
gaagttgatgtctggagtatcggctgtatcatgtacacactgttggttggtaaaccgccg
tttgaaacctcaagtctacgcgaaacttatgcccgtattaagactgttaattacaaaacc
ccatcaaatatcagcagcaccgctatttcgatgataacgaacacactgcagggaaaccca
accaaaagacccagtgttatgaagttactcaaggatccatttttcacatctggatacatg
ccacgaagtcttccattgtcgtgtttaacaatggcgccacgtcttgacactcttgagtca
cataatcgcaagccactgtctgaaatgaatcaaaatgaagaggatgaaaaagcagtattt
cgcataccaacaagtccagcaccgcgtgctggcactaaaacacccgaatcccaaacagat
gcgcagaaatctggtcgcaatatcaagcgcatgctgataacattgaaggaacaagttact
gcagtcttggctgctaaaccaggtcgtactgacgcgtcattggctgtggaaaatactgat
ccttcggctcaacctctggtttgggttagcaagtgggttgattattcagacaagtatgga
tttgggtatcagctgtgtgatgatggagtcggtgtcatgtacaatgatggaacaagactt
attatgttagctaacaaatttaatattcattacatcagtcgtgatcttactgagacttat
tatactgtaaaagattatccggaatcgttagaaaaaaaaatgaagttaatgacattcttt
ttgcaatatatgaatgagcatcttatgaaagccggtggctcggttgctgttaaaaatgac
gccatgtcacgtgtaccctacatgcatcaatggttccgcacacaaactgcggttgttatg
cagttgaacaatggaactgttcagatcaatttcttggatcactcaaaaataattatgtgt
ccattaatggctgctgttacttacattgatcaagaaaagaatttccgtacgtaccgtttt
gaaacaatacaatcaaatggatgtagcgctggacttgcacgcaatttggaatatgcactc
gaaaagcttgaacttatgattgcaaactcgcgacaaaattaa

DBGET integrated database retrieval system