KEGG   Microplitis demolitor: 103575903Help
Entry
103575903         CDS       T05600                                 

Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
mdl  Microplitis demolitor
Pathway
mdl00190  Oxidative phosphorylation
mdl01100  Metabolic pathways
Module
mdl_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103575903
Enzymes [BR:mdl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     103575903
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     103575903
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa DUF2087
Motif
Other DBs
NCBI-GeneID: 103575903
NCBI-ProteinID: XP_008554121
Position
Unknown
AA seq 265 aa AA seqDB search
MAFFISNNVRAFARLLSVPLSKRCLSTSVIRSSQTSTESEDESRVSIVRKSFADNIDSIK
NFGKYVADCLPKYVQAVQMASKDELEILVAPQGIRPVLSFLKEHQNAQYTILADLTALDV
PSRPCRFELVYNLLSIRFNTRIRVKSYTDELTPVDSVVSLFKAANWYEREVWDMFGIYFT
DHPDLRRILTDYGFEGHPLRKDFPLSGFVEVRYDDEVKRVVAEPLELAQEFRRFELSTPW
EQFPNFRKTHSSEKIGDEKTESPPK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggcattttttatttcgaataatgtcagggcttttgctcgtctgctgtctgttccactg
tcaaaacgttgtctatcaacttcagtcatccggagttcccagacgtcaacagaatccgaa
gatgaatcacgagtatccatcgtacgaaagtccttcgcagataacattgattcaataaaa
aatttcggtaaatatgtcgctgattgtttgccgaaatatgtacaagcagtacagatggca
agcaaagatgaacttgagatccttgttgccccgcaaggaattcgtccagttctatcattt
ttgaaagaacatcaaaatgctcagtatactattttagcagaccttacagcgcttgatgtt
ccaagtagaccatgcagatttgaacttgtatacaatctcttgtctattcgattcaatact
cgaatcagagtgaaatcttacactgatgagctgaccccagtagattctgtggtttctctt
ttcaaagctgctaattggtacgagcgagaagtgtgggatatgtttggaatttactttact
gatcatccggatcttcgaagaatcctcactgactacggttttgaagggcatccattgaga
aaagattttccgctcagtggattcgttgaggtcagatacgatgatgaagttaagcgtgta
gttgccgagcctttggagttggcacaagaatttcgcaggtttgaattatcaacaccctgg
gaacagtttcccaattttcgaaaaactcactcatcggaaaaaattggggatgaaaaaact
gaatcgccgccaaagtag

DBGET integrated database retrieval system