KEGG   Microplitis demolitor: 103576330Help
Entry
103576330         CDS       T05600                                 

Definition
(RefSeq) mitochondrial enolase superfamily member 1-like
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
mdl  Microplitis demolitor
Pathway
mdl00051  Fructose and mannose metabolism
mdl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    103576330
Enzymes [BR:mdl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     103576330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-GeneID: 103576330
NCBI-ProteinID: XP_008554711
Position
Unknown
AA seq 444 aa AA seqDB search
MTCIVKVFVKDIRFPTSLQADGSDAMHTDPDYSCAYVTIKLKNGLEGHGLTFTLGRGTQI
VVKACEDILKMVINRNVYDIFNNFGKFWRDITSESQLRWLGPEKGVIQLATAAVINSLWD
LWSRIRNVPLWKLLTDLTPEQLVSTIDFRYITDVITPEEAINILKERQEGKEERENHLLT
HGLPAYTTQVGWLGYSDEKVRQLCRKYLKEGYRSFKVKVGRDLQDDIRRCGLVREEIGSD
NKLMVDANQIWGVGEAIEWMKHLEKFKLAWIEEPTSPDDILGHRRIAEAVRPLGIGVATG
EACANRVIFKQLLQLRAIDYCQIDSARIGGVNEVLAVYFMAYKLKVPVCPHAGGVGLCEM
VQHLQMWDYISLSGTTDNRIIEYVDQQHEHFVNPTIVKNGHYMPPSLPGYSTKLKDQAIL
DYEFPQGKEWQRMFNEGIYPKQID
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgacttgcatagtaaaagttttcgttaaagacatccgatttccaacttctttgcaagcc
gacggaagtgacgctatgcacactgatccagattactcttgcgcttatgtaacaattaaa
ttgaaaaatggacttgagggacacggtcttacatttaccctcggaaggggaactcaaatc
gtggtaaaagcatgcgaagatattttaaaaatggttataaatagaaatgtttatgatatt
tttaataattttggtaaattttggagagatattactagtgaatcacaattacgttggttg
ggtccagagaaaggtgttatccaattagcgacagcagctgtaattaattcattatgggat
ttatggtcgagaataagaaatgtacctctgtggaaattgttaacagatttaacacctgag
caattagtttctacaattgatttccgttatattacagatgtaataacgcctgaagaagcg
attaatatattaaaagaaaggcaagagggtaaagaggaacgagaaaatcatctactgacc
cacgggttaccggcttacacgacccaagtcggctggctgggatattctgacgaaaaagtc
cgtcagctgtgcaggaaatacctgaaagaaggctacagatccttcaaagttaaagtaggc
cgcgatttgcaggacgacatcaggagatgcgggctagtgcgcgaggaaataggaagcgac
aacaaattgatggtcgacgcaaaccagatctggggagtgggcgaggccattgagtggatg
aagcacttggagaagtttaagcttgcctggatcgaggagccgacttcgccggatgacatc
ctggggcacagaagaatagcggaagccgtgaggccgctgggaattggagtcgctactggt
gaagcttgcgctaatagggtcatatttaagcagctgctgcaattgagggccatcgattat
tgtcagatcgactcggcgagaatcgggggagtcaatgaagttcttgctgtttatttcatg
gcttacaaattgaaagttccagtgtgtccacatgccggcggagtcggactctgtgaaatg
gtacagcatttacaaatgtgggattacatctccctgagtggtaccaccgataaccgaata
attgaatacgtggatcaacaacacgaacactttgtaaatcctacaatagtcaaaaatggg
cattacatgccgccaagtcttcctggctactcaacaaagctcaaagaccaagcgatcctc
gactacgagtttcctcagggcaaagagtggcagcgaatgttcaatgaagggatttacccc
aagcagatcgactaa

DBGET integrated database retrieval system