KEGG   Microplitis demolitor: 103576702Help
Entry
103576702         CDS       T05600                                 

Definition
(RefSeq) probable maleylacetoacetate isomerase 2
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
mdl  Microplitis demolitor
Pathway
mdl00350  Tyrosine metabolism
mdl01100  Metabolic pathways
Module
mdl_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103576702
Enzymes [BR:mdl01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     103576702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Tom37
Motif
Other DBs
NCBI-GeneID: 103576702
NCBI-ProteinID: XP_008555249
Position
Unknown
AA seq 217 aa AA seqDB search
MSVMGKPVLYSYWRSSCSWRVRIALNLKEIPYDIKPVSLVKAGGEQHCNEYREINPMEQV
PALHIDNHTLIESLNIMQYLEETRPHRPLLPADPVKRARVREICEVISSGIQPLQNLVVL
IYVGEERKKEWAQHWITRGFTAVEKLLSSSAGKYCVGDEITLADCCLVPQIFNARRFHVD
LRPFPTILRVDRHLENHPAFTAAHPNNQPDCPPEATK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttatgggcaagccggtactgtactcatattggcggagctcttgttcatggagg
gtgagaattgctctcaatttaaaagaaattccatatgatataaaaccagtaagtttagta
aaagctggcggcgagcaacattgcaatgaatatagagagattaatccgatggaacaggtt
ccggcacttcatattgataatcatacgttaatagaatcattaaatattatgcaatacttg
gaagaaacacgaccacatcggcctttactgccggcagatcctgttaaaagagctagagtt
agagaaatatgcgaagttatatcaagtggtattcagccgctacaaaatttagttgtttta
atttatgtcggggaggaacgtaaaaaagaatgggcgcagcattggattacccgtggattt
acagctgttgaaaaattactgtcgtctagtgctggtaaatattgcgtgggagatgaaata
actctagcagattgttgcttagtaccgcaaatatttaatgcaaggaggtttcacgttgac
ctgagaccttttccaacaattctcagggtcgatcgtcatttagaaaaccacccggctttt
acagcagctcatcctaataatcagcctgactgtcctccagaagcgaccaagtag

DBGET integrated database retrieval system