KEGG   Microplitis demolitor: 103576893Help
Entry
103576893         CDS       T05600                                 

Definition
(RefSeq) gamma-glutamyltranspeptidase 1 isoform X1
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
mdl  Microplitis demolitor
Pathway
mdl00430  Taurine and hypotaurine metabolism
mdl00480  Glutathione metabolism
mdl00590  Arachidonic acid metabolism
mdl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103576893
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    103576893
   00480 Glutathione metabolism
    103576893
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mdl01002]
    103576893
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mdl04090]
    103576893
Enzymes [BR:mdl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     103576893
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     103576893
    3.4.19.14  leukotriene-C4 hydrolase
     103576893
Peptidases and inhibitors [BR:mdl01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   103576893
CD molecules [BR:mdl04090]
 Proteins
  103576893
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 103576893
NCBI-ProteinID: XP_008555551
Position
Unknown
AA seq 586 aa AA seqDB search
MFGLSKKTIVIGVAGLAVIIIIITACVIFLKNFEEIRKEDNSEKNSRFVSSSYLGKYQKA
AVSTNGVECAEIGNNMLLKNGSAVDAAIAALLCEGVASLHSMGLGGGFLMTIWDAKTGQA
EFLNARETAPAKATKNMYGGNATSSMYGGKAVAVPGELLGYWEAHRKYGRLDWADLFTPT
IELCERGVPVNGYLAQVLLRKISYIKAEPTLAEILIDPRTNSTWAVGDRIKRPRLAETLK
VIAKYNVSVFYNGSIGEEIVKEIQGFGGIIEMNDLRNYRVEWKKPITSKLGNLTIHSAAL
PGSGVILTFILNVLEKFLPMGISEEIFWQRIVETFKWAYAHRTELGDDNFVELDDLITNL
TSKSYAEGIREKIKDYWTSNDPKFYGAVTDTPIDSGTAQVSVLAPDGSAVSVTSTINQVL
GAMIRSKSSGIIFNDQMDDFSSPNITNGFDLPPSPANFIVPGKRPLSSMTPTIVVDKTGE
VQLVLGAAGGTKITTGIASTMILNLWRGYNIKEAVDARRLHHQLLPMRLEAEPNFPKKIL
EFLTGLKHNVSYYGGLGSAVTAISKINHPGVTANSDYRRIGSIAGF
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcttgtccaagaaaacaatagtaatcggagtcgctggacttgctgttattatt
attatcattacggcatgtgttatttttttgaaaaacttcgaagaaataagaaaagaagat
aattcggaaaaaaattcaagatttgtcagttcgtcgtacctgggaaaatatcaaaaggcc
gcggtatcaactaatggagtagaatgcgcggaaataggaaataatatgctactgaaaaat
ggttctgctgtcgatgctgcaatagcggcattgttgtgcgaaggagtcgcatcacttcat
agtatgggattgggaggtggatttttgatgacaatatgggacgctaaaactggacaagcg
gaattccttaatgctagagaaactgcgccagctaaagctacaaagaatatgtatggtggc
aatgctacttcttctatgtacggtggaaaagctgtagcagttccgggagaattattaggg
tactgggaagctcatagaaaatatggaagacttgattgggcagatttattcacacctaca
attgaactttgtgagcgaggagttccagtgaatggttatcttgctcaagtattattacgt
aaaatatcttatatcaaagctgagccgactttagctgaaattcttatcgatccgcgaact
aattcaacatgggcggtcggagacagaataaagagaccgagactagcagaaactttgaag
gtgatagctaaatacaatgtcagtgtcttttacaatgggagtataggtgaagaaatcgta
aaagagattcaaggctttggtggaattattgaaatgaatgacttacggaattacagggtt
gaatggaagaagccgataacgtcaaagctcggtaatttaacaattcattcggcagcatta
cccggttcaggagtaatattaacatttatacttaacgtactcgaaaagtttcttcctatg
ggcattagcgaagaaatattctggcagcgtatcgtagaaacattcaaatgggcatacgct
caccgtacagaactaggcgacgataattttgttgaattagatgacttaattaccaatcta
acgtccaagagttatgccgaaggaatccgtgaaaaaataaaagactactggacaagtaat
gatcccaagttctacggagcagtcacggatactccgatagactctggaactgcacaagta
tccgtattggctcctgatggttcagcggtatctgtaacatcaacaatcaatcaagtatta
ggagcaatgatacgatccaagtcttcaggaataatattcaacgatcaaatggatgacttt
agttcgccaaacataactaatggatttgatttacctccttcaccagctaatttcatagtg
cccggcaagagacctctcagttcaatgactcccacgatcgttgtcgataaaacgggagag
gtccaactagtgttgggagcagcaggaggtacaaaaataacaactggaatagcatcgaca
atgattttgaacctctggcgcgggtataacatcaaagaggccgtagatgcgagacggctc
catcatcaattgctaccaatgaggcttgaagctgagccaaattttcccaaaaaaatactg
gaatttttgacgggtctaaagcataacgtctcttattacggaggtttaggaagcgcagtg
acggcgatatctaaaataaaccatccaggtgtgactgcaaactccgattatcgtcgaatt
ggatcaatagctggcttctaa

DBGET integrated database retrieval system