KEGG   Microplitis demolitor: 103576974Help
Entry
103576974         CDS       T05600                                 

Definition
(RefSeq) protein 5NUC-like
  KO
K19970  5'-nucleotidase [EC:3.1.3.5]
Organism
mdl  Microplitis demolitor
Pathway
mdl00230  Purine metabolism
mdl00240  Pyrimidine metabolism
mdl00760  Nicotinate and nicotinamide metabolism
mdl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103576974
   00240 Pyrimidine metabolism
    103576974
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    103576974
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mdl04090]
    103576974
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mdl00537]
    103576974
Enzymes [BR:mdl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     103576974
CD molecules [BR:mdl04090]
 Proteins
  103576974
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mdl00537]
 Enzymes
  103576974
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5_nucleotid_C Metallophos
Motif
Other DBs
NCBI-GeneID: 103576974
NCBI-ProteinID: XP_008555657
Position
Unknown
AA seq 553 aa AA seqDB search
MHSRFEQIRSTSSECFPYYTSKQGKCYGGFARIATLVRKAKNSTIPTLFLNAGDTYQGTV
YYTVHKWKIVSKFLNLLKPDAISLGNHEFDDGPEGLVPFINAAEFPIVTSNLDLTGEPEL
AAATKLSNSTVITVDGRKVGIIGYLTPETKVISSPGKVVFLDEVESVRREVDKLRADNVT
IIIALGHSSFDADKKIAAEVDGVDLVIGGHTNTFLYSGRKPDLEVPEGLYPTEVIQKNGR
KVYVVQAYAYTKYLGNLSITFDAAGEIRSILGNPILVTSDIEQAPDILHELEAWRPTDEL
LTNTPLGFTKVSLDGDKKRCRSRECNFGNLITEAMVDYNAKQYLTGFGWTDASIAIINSG
IIRKSINKALDTPVTMKDVLESLPFYNAIVKVKMTGNVIFEMLEHSVDALVCKKTCPITG
RFLQFSGLTVIYNISQPQGHRVVRDSVFVLCSKCRTPIYEVIDPNKTYTILMTDYLLNGG
DGYKMLRNLTWTNTGVTTDQILVYYLINKSPVFPIIDNKIMFFVNDNNNSIPNNMCNFTL
ITLSVFILLYCIT
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgcattcgagatttgaacagataaggtcgacgtcatcagagtgctttccttattatact
tctaaacaaggcaaatgttacggaggattcgcgcgaattgcgacactagtgcgtaaagca
aaaaattcgacgataccgacgttatttttgaacgccggtgatacatatcaaggaacggta
tattataccgtacataaatggaaaatagtttcgaaatttctcaatcttttgaagccggat
gcgatttctttaggaaaccatgagtttgatgacggacccgagggattggtgccgtttatc
aacgcagcagagtttcccattgtcacgagcaatttggacctcactggggagccagagctg
gcagccgcgacgaagctaagcaacagcactgttatcacagttgatggcagaaaagtcggt
attataggatacttgacgcccgagacaaaagtaatctcgagtcctgggaaagttgtcttt
ctcgacgaggttgagtccgtcagacgggaagttgataaactccgagccgataatgtgaca
ataataatagcactcggtcactcgagttttgatgctgacaaaaaaatagccgctgaagtc
gacggcgtggacttggttattggcggtcatacaaacacttttctctacagcggacgcaaa
cccgatttggaagtacctgagggactgtaccccaccgaagttattcaaaaaaacggacgt
aaggtttacgttgtccaggcttacgcttacaccaagtatctcgggaatctctcgattact
ttcgacgctgccggagagattcgcagcatccttggaaatcctattctcgtaaccagcgac
attgaacaagctcccgacattctccatgaactcgaagcatggcgacctaccgacgagctt
ctgaccaatacaccattaggcttcaccaaagtctctctcgacggcgataagaaacgttgc
cgtagccgagaatgtaacttcggtaatcttatcactgaagccatggttgattacaatgca
aagcagtatttaaccggattcgggtggactgatgcttcaattgctatcataaacagcgga
atcattagaaaatccatcaataaggcccttgacactcctgtcacaatgaaagacgtacta
gagtcattaccattttataatgccatagtcaaagtaaaaatgaccggcaatgttattttc
gagatgctagaacacagcgtcgatgcattagtctgtaaaaaaacatgtcccattactgga
cgatttttacagttttctggtcttaccgtaatttataatatatcacagccacaaggtcac
agagttgtccgcgactcagtatttgtgctgtgctcaaaatgtcgtacgccaatttatgaa
gtgattgatccaaataaaacatatactattcttatgacagattatttgctgaatggaggg
gatggttacaaaatgttgagaaatttaacatggactaatacaggagtaacaacggatcaa
attttagtatattatttaataaataaaagccctgtttttccgataatagacaacaaaata
atgttttttgttaatgacaataacaacagtattccgaacaacatgtgcaatttcacactc
attactttatcagtttttatacttttatattgtattacctaa

DBGET integrated database retrieval system