KEGG   Microplitis demolitor: 103578630Help
Entry
103578630         CDS       T05600                                 

Definition
(RefSeq) delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
mdl  Microplitis demolitor
Pathway
mdl00250  Alanine, aspartate and glutamate metabolism
mdl00330  Arginine and proline metabolism
mdl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103578630
   00330 Arginine and proline metabolism
    103578630
Enzymes [BR:mdl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     103578630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 103578630
NCBI-ProteinID: XP_008557992
Position
Unknown
AA seq 570 aa AA seqDB search
MNSNIKYTFNCFVNKCGTRCLSHVKNLSIVQDINLKEIPLVNEPVLSYKKNSRERDDLIE
ALKHKSIECQDIPIVIGDEEIRTDNIKYQVMPHNHSKKIAKYYHASTDIIKKAIDNSVKS
QRTWDAVPLDKRIDIWMRAADLMATKYRQELNSATILGQSKTAIQAEIDSAAELVDFFRF
NAYFLQESLKYRPISPKESINSMRHRGHDGFIAAISPFNFTAIGGNLAYTPALMGNSVLW
KPSDTAILSGWTIFKICREAGVPAGVVNFIPAAGPDFGDTITQSPYLSGINFTGSPATFN
HLWSQVGANIQTYINYPKLSGECGGKNYHFIHPSANTEHVVLSTIRSAFEYSGQKCSACS
RMYVPESLWPTISERLVSVTEELKLGPADDFTVFSSAVIDAAAFKRITSYINYAKTSPNT
RIIAGGTYDDSVGYFVRPTVIVTTDPMDKLMQEEIFGPVLTIYVYQDRDLDSAMNLVEKT
TPYALTGSIFTQDREWAVAALEKFKYTAGNFYVNDKSTGAVVGQQPFGGHRKSGTNDKSG
GPVYVHRWSSPQTIKETFVTLNNYKYEYMH
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaaatattaaatatacatttaattgttttgttaacaaatgcgggacgagatgt
ctgagtcatgtaaaaaatttatctattgtgcaggatataaatttgaaggaaataccgctg
gttaatgagccagtattgagttataaaaaaaatagcagagaacgtgatgatttaattgaa
gcattgaaacataaatcgatagaatgtcaagacattcctattgttattggtgatgaagaa
atacgcactgataatattaagtatcaagttatgccgcataatcacagtaaaaaaatcgca
aaatactatcacgcaagtactgatataataaagaaggcgatagataattcagtaaaaagt
cagcgaacatgggacgcagtgcctcttgataaacgaatcgatatctggatgcgagccgct
gatttgatggcaacgaaataccgccaggaattaaattcagcaacaattttaggacaaagt
aaaacggcgatacaggcagagatagacagcgctgctgaactagtagattttttccgattc
aacgcgtactttttacaagaatctttaaaataccgcccgatttcgccaaaggaatcaata
aactcgatgcgtcatcgtggacacgacggtttcattgccgcgatatcgccattcaacttc
acagcaataggcggtaacttggcatacactccagctctgatgggaaactcagtcctctgg
aagccatcggacactgcgatactttctgggtggactatttttaaaatttgccgtgaagcc
ggcgtacctgcgggagttgtcaattttattccagcagctggtccagatttcggtgacacg
ataactcagtcgccttatctgtcaggtatcaatttcaccgggtctccagcgacattcaat
catctctggtcccaagtaggcgccaacattcaaacttacatcaattacccgaagctttct
ggcgaatgcgggggcaagaattaccacttcattcatccatcagccaacacagagcacgtg
gtcttgtcaacaataagaagcgccttcgagtacagcggacaaaaatgttcagcatgcagc
agaatgtacgtacctgagtccctctggccgacaataagcgagcgcttggtctccgtcacc
gaagaattaaaactgggaccagccgacgacttcacagtattctccagtgcggtaattgac
gcagcggcattcaaacgaatcacttcgtacataaactacgccaagacttcgcccaacacc
cggatcatcgccggcggaacttacgacgactctgtcggttacttcgtacgacccaccgtc
atagtgaccaccgacccaatggacaaattgatgcaagaagaaatattcggtcccgttctc
accatttacgtttaccaagaccgggatctagattccgcgatgaacctcgtggaaaaaact
accccctatgcgctcaccggttccatttttacccaagaccgcgagtgggctgtcgcggct
ctcgaaaaattcaaatacacagcgggtaatttttacgtaaatgacaaatcaactggagcc
gtagttggacagcagccttttggtggtcatcgaaagtcaggaacaaacgacaaatccggc
ggaccagtttatgttcacagatggtcatcaccccaaactattaaagaaactttcgttaca
ttaaataattataagtatgaatacatgcattaa

DBGET integrated database retrieval system