KEGG   Microplitis demolitor: 103579775Help
Entry
103579775         CDS       T05600                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
mdl  Microplitis demolitor
Pathway
mdl00010  Glycolysis / Gluconeogenesis
mdl00562  Inositol phosphate metabolism
mdl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103579775
   00562 Inositol phosphate metabolism
    103579775
Enzymes [BR:mdl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     103579775
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     103579775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF3885
Motif
Other DBs
NCBI-GeneID: 103579775
NCBI-ProteinID: XP_008559516
Position
Unknown
AA seq 456 aa AA seqDB search
MNYKFLFIFLSMTFSMTLSVDSLKCTSKSDDFNCRLTSMTPYRYIANYDDSEINFPGCEA
KKMWLLIRHGTRYPSKGVLNEMEQLVELRDKILLNCNAGNCNLTDTQLINLANWKFSIDK
NKEMTLAEEGGVEMRGLAERYQSRFPELMPDKYDNRTYKFKFTSKQRTKESAGNFTVGLF
GKNGSFDVEYPLAEEKDRILRFYKACDKWLRDIDDNPEAYSEVEKFKASEVMTKALNDLS
SRLGVTIDYDRAKSIRSTCAFETAWHENSKSPWCELLSPDEFQIMEFSHDLKYYWIDGYG
YPLTYQHACTAIGDMFKFLETNDGLKVSAYFTHSGTLLKVLSLLGLARDPTPLVHNSYNS
SEDRLWRVSLIDAFASNLAFISYECKSPAQEPAEDAQTKKVSVKNDLKERSILLMHQERI
VNLPGCPKDFPCPLAVMRNKYPDEEDECEFDKMCKL
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaagtttttatttatttttttaagtatgacatttagcatgacattgtctgtt
gatagtttaaaatgtactagcaaaagtgatgattttaattgtcgcctgacttcgatgact
ccgtatcgttacatcgccaattatgacgacagtgaaattaatttcccaggttgcgaagct
aaaaaaatgtggctgctgataagacacgggactaggtatccaagtaaaggggtattgaac
gaaatggaacaacttgtagaattgcgtgataaaattttattaaattgtaatgctggtaat
tgtaatctgacagatacacaattaattaatttagctaattggaaatttagtatcgataaa
aataaagaaatgacattggctgaagaaggaggcgttgaaatgcgaggacttgctgaaaga
tatcaatcaagatttcctgaattgatgcctgataaatatgacaatcgtacttataaattt
aaatttacgtcaaagcaaaggaccaaagagagcgctggtaattttactgtaggtttattt
ggtaaaaatggtagttttgatgttgaatatccattggctgaagaaaaagatcgtatatta
agattttacaaagcgtgtgataaatggctacgagatattgatgataatcctgaagcttat
tcagaagttgaaaaatttaaagcttcagaagtgatgaccaaggcattgaatgatttatct
agccgtcttggtgtgaccattgactacgatagagcgaaatcaattcggtcaacgtgcgca
ttcgagacagcttggcatgagaattcaaaatctccctggtgcgagcttttatcgccagat
gaatttcagattatggaattcagtcatgatcttaagtattattggattgatggctatggg
tatccattgacatatcaacatgcgtgtactgctatcggagacatgttcaaatttttagag
actaatgatggattaaaagtatcggcttacttcacacactcgggaacacttctaaaagtt
ttatctctcttgggattagctcgagaccccaccccactcgttcataactcgtataattca
tccgaagacagattatggagagtaagtctcatcgatgctttcgcaagcaatttagcgttt
atttcctacgaatgtaagtcaccagcacaagaacctgctgaggatgcgcagacaaaaaaa
gtatccgtaaaaaatgacctaaaagagcggagtattttattaatgcatcaagaacgtatc
gtaaatctccccggttgtccaaaagattttccttgtccgctggcggtgatgagaaataaa
tatcccgacgaagaagatgaatgtgagtttgataaaatgtgtaagctatga

DBGET integrated database retrieval system