KEGG   Microplitis demolitor: 103580012Help
Entry
103580012         CDS       T05600                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
mdl  Microplitis demolitor
Pathway
mdl03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103580012
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mdl03041]
    103580012
Enzymes [BR:mdl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     103580012
Spliceosome [BR:mdl03041]
 Complex C
  Other components
   Step II factors
    103580012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 Helicase_RecD AAA_19 ABC_tran AAA_30 T2SSE Uroplakin_II AAA_29 FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 103580012
NCBI-ProteinID: XP_008559827
Position
Unknown
AA seq 762 aa AA seqDB search
MDTLKLLKYFSDYKDSSGIVEAEPAFIKVYREENKVSATDKLIKNPNGSLAQAANLQYKF
FRDRQKRNMMESNFQSLLFGSKPEENKTLASSTSGPDLVQQIKALELEEESAGLLNSSSI
DRESLPIYNMKDELIKAVSKNQFLIILGETGSGKSTQITQFLADAGFAEKGEICCTQPRR
VAARSIAERVAEEFGCHVGEEVGYVMRFENCTSDKTIIKYVTEGILLRECMSHPVLKPYK
VIMLDEAHERTIYTDVLFGLLKIIATRRSDLRIIVTSATLNATKFSEYFNDAPIFTIPGR
TFDVKIDFLKSPELDFIEATSAAVLRIHQQEPPGDILVFLTGQQEIDEVCRILRKRLESL
SPDVGELVILPAYAALSPSQLNEIFDPVPAGSRKAVVATNIAETSITINGIYYVVDAGLA
KQVVFNPKTEICGLFTTPISQASAIQRAGRAGRTGPGKCYRLYTENAFEEEMWPTTIPEI
KRTNFSSTLLQLLAIDVFHLSSSGFMDFPSRDFMLLALKTLHSLRAVDEKGITNLGKMMA
SFPVDPCLARMLIMSVLFKCSEEILTIVSIFSVIDHFQRFFYHLPSDKEKATAVKSNRDK
FVNSDGDHLTFLAAYNLWNESDDGDDWCSENYVNHSVLVSAQKIRKHLAELMEKHHFEVT
SANNNMEPVKLAICSGLLRNVARLHDLVIKSYYQTVVSNQLVHIHPSSILADNKERYLVY
HELSQIQNQKVFMKYVMTIKPQWVAAFVNYDFSKIDWFNTPI
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggatacccttaaattgttaaaatatttttctgattataaagattcaagtgggattgtt
gaagccgaaccggcatttataaaagtgtatcgtgaagaaaataaagtgtcagctactgat
aaattaattaaaaatcccaatggatctttggcgcaagcggcaaacctgcagtataaattt
ttccgggatcgtcaaaagagaaatatgatggaatcaaattttcaaagtctgctatttggt
agcaaacctgaggaaaataagaccctcgcatcatctacaagtggaccggacttggtgcag
cagataaaggccttggagctggaggaagaatcagcgggacttttgaatagttcgtcaatt
gatcgcgagagtctgccgatttataatatgaaggatgagttgatcaaagctgtaagcaaa
aaccaatttttgattattcttggggaaactgggtctggtaaatcgacgcagattactcag
tttttggcagacgctggatttgcggaaaaaggcgaaatatgttgcacgcaaccgaggaga
gttgctgcgaggtcgattgctgagagagttgctgaagaatttgggtgtcatgttggtgaa
gaagttggctatgttatgcgatttgagaattgcacaagtgataaaacaattattaagtat
gttactgaaggtatacttttgcgtgaatgtatgtctcatccggttttaaagccttacaaa
gtaataatgctcgatgaagctcacgagcgtacaatttacacagatgttttgtttgggtta
ttaaaaataatagccactcgaagaagtgatttaaggataatagtaacaagtgctacacta
aatgctactaaattttccgagtattttaatgacgccccgattttcacaatacctgggcgt
acatttgatgtcaagatagactttttgaagtcgcctgagctggatttcatagaagcgact
tctgctgctgtgctgcggatccatcaacaagaaccaccgggagatattttggtatttctg
actggtcaacaggagatcgatgaagtctgcaggattcttcgtaagcgtctggagtctctg
agtccagatgtcggtgagctggtgattcttccggcctatgcggctttgtcgccgtctcag
ctgaacgaaatatttgatcccgtacctgcaggatcacgcaaagctgtcgtggcaacgaat
atcgctgagacaagtatcactatcaatgggatttattacgtcgtggatgctggcttggcc
aagcaggtggttttcaatccaaagacagaaatatgtggtctgttcacgacacccatcagc
caggcttctgcgatacagcgcgcgggacgtgcaggcagaactgggccaggaaaatgttac
agattgtatactgaaaatgctttcgaagaagaaatgtggcctacaactattccagaaata
aagagaaccaatttttcgtcgactttgctgcagttgctggcaattgacgtgttccatttg
tcgtccagtggttttatggattttccgtcccgagatttcatgcttctcgcgcttaagaca
ctgcacagtcttagagctgttgatgaaaaaggaatcaccaatctggggaaaatgatggca
tcgtttcctgtagatccctgtcttgcgagaatgctgattatgagcgtacttttcaaatgc
tctgaagaaatattaacaattgtcagtattttctctgtaattgatcattttcagcgtttc
ttctaccacctgccaagtgacaaagaaaaagcgactgctgtgaaaagtaatagagataaa
tttgtaaattccgatggggaccatctcacttttttggctgcatataacttgtggaatgaa
agtgatgatggtgatgactggtgctcggagaactatgtcaaccacagcgtattagtgtcg
gctcaaaaaattcgtaagcatttggccgagctaatggagaaacatcattttgaagtcaca
tcagcaaataacaacatggaaccagttaaactggccatttgctctggattgcttcgcaat
gtggcaagattgcatgatctcgtcatcaagagctactaccaaactgttgtcagcaatcag
ctggtacacatccacccgagcagcattttagcagacaataaagaaaggtacctggtttat
cacgaactgtcacaaattcaaaaccaaaaagtgttcatgaagtatgtgatgactatcaag
ccgcagtgggttgccgcgtttgttaattatgatttttctaaaattgactggttcaatact
cccatataa

DBGET integrated database retrieval system