KEGG   Microplitis demolitor: 106693507Help
Entry
106693507         CDS       T05600                                 

Definition
(RefSeq) titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
mdl  Microplitis demolitor
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdl01001]
    106693507
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mdl04131]
    106693507
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mdl04812]
    106693507
   04147 Exosome [BR:mdl04147]
    106693507
Enzymes [BR:mdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106693507
Protein kinases [BR:mdl01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   106693507
Membrane trafficking [BR:mdl04131]
 Others
  Actin-binding proteins
   Others
    106693507
Cytoskeleton proteins [BR:mdl04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     106693507
Exosome [BR:mdl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106693507
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig V-set Ig_2
Motif
Other DBs
NCBI-GeneID: 106693507
NCBI-ProteinID: XP_014296935
Position
Unknown
AA seq 3556 aa AA seqDB search
METEQPHTHQKYQVLSSQQIPRFIQEITDIYTEAGQKVVFETIYSGHPAPVVVWFKDDKM
IASTKNVKVKLSEEEKKTSVLILHATPEDEGTYVCKATSDIGLATTKAKLRVSGTYETGD
DNWEVEEQPEEVPEEKPKRKKRLEMKRAKETKEKMKALKVRVEKRKDALKEKATASEQPD
DKSIVDVEETQVLESTDVIEHEAFETTKAHRVISVQEPVITEATASLKKVDEKTQKIVPR
REDRARPVVLEQEALVVGSEIVTQDTTADFKIQSTTDRAQVTSETFETVSVSEVHTESSV
QEIKRTDSKTRRAKKTVVSSQEGVVEVRQTQVEEFLDEKPKKKKDRKRDVVEVTIEEVIK
EQKVNLLRAVEEIMELLNVREFGPGESPLRELATIGFLVSHGVPVSEINEALYRTDQFPA
LRTPDAQNALVQLVEREGHGALITQVLTEETTTDEAIVAATVGFRAFMRMVELIHTTVEE
VITHFAPEDFRPRAWEVTEITEAEVEEHMTERVSVVQTTEVRVMEYEDTQLVHETLHKEI
KPEEHGSRVVEDTQEQDRESIDIEEETVVTERDEGRLVRKKPKKEQRREKKEDEVVVVEE
EEIVTRKIKKPQKKQKEEIEIEIEEEEIIEEEEEGEKRKKILKAKRPKKGEEEIDFEEVE
DFETVRDKAVSSVPVNTSVQSHEVVALTRTAEQAPGKPESEKARVTLDTVNALVEQYVPV
QESEDKISKVKPDEKKALVSVAPVEPFSITETTVQGSHGEFKGTFKPTTFEATPGFVTKP
KESLQVTETLANDAKTTGLDLKQALTTQKAEVALTLQEATTVSETTVNQGEVPTQDFVAP
TAVTAEDTMLPNISLSIYEVNEAVTEDKLEPTKTISAKPRVNISAVEPLTIEEVQTEDKP
GKYYPELFVPTEIATTTVVSQKRVITEETHAPEKEGEYVPGRLPAGQKAQVGVSEGGEAP
MIGEHPIQEMEGVFVPGRKADTFEAETNVNVLESVTVSTVETQHQEVNLVVEEAKKAVAD
LNVVEKSSVFTMETVTSEREVEYKPEEQPSVKTADSSILPLEIGSISSTIVQESEGIYNE
QVRPTSAIAETSLRPEEHVTVSQVETADLPSKFSEDLKYITESGTVSVQLTEAKVIQETF
THDREEKFEDSVKPEEKIVDMIYDSVKGIEIFQTTSVDKEGHLEIYEMPESHRGKMVPTH
SVISFQVEETQPEDNVGKLDKLVPITGKAKVGHDNLVETVVDITVVDEGLKPVEKDQVPE
SKFAEVGLNEVESVKTTEIIVNETEEDYRSVTKMESVFATTGFTTQSAIELQEVRTESPT
GEIPEEVRASGTAQTSAVPLESVTVNLQEVAEKEDIYTEDIRPESKTASIDYTETRSGAS
VLEVLTHDLENTYRPDEKPRDFTASSSIDSRTIAMKSEVLIEQSAGKMSDDKPKTAKAFG
TQEALDELVVVETNIAETEKPRFEEAKPVEQKAQVDITTSENVSVMEITAVHAEETLHTE
DDVSEKTITMNLTSTHEVAQTEETVVANNIDSLSEVKPKTESAILHQSGLEIVQQTELTV
SEKESVLLEDVKPDLKNVNVSFTEGESVQVLLTNSEDKEGRLEDQVKPKSFEASIDFEVQ
GVASQYEVMSDTGVSEFTSEVPKDAKPSETLLLYETAVAEEIQTRETEAPLTEIQPGNRL
AELLFEIGEGILVSTVETGDKERPLEELEKPENKSATFDFESHPVAEALETIAQDDAGEF
KPEETQSATALMDHVAHKSIVTIETSVGDREGFMDDFVKPEEKVVDVAFEEAKICLNITE
TISSEKEKEYVGKEDVMTEKATFNFDAHKVAELTEVTTSSITDELKEKAPTSAIAKEERL
PFEGVIQTEAVISEKEKEFSESPIIATNKADIIIGDKGNVSSVSEVMIVDKEGSLKIPEK
PEERRASIDMTGHSIAEKIEVNVDSSTGVFGELQKVSASAIPSQIPLEPVVQTETQPSES
EGLLTKDKKPIKALADLSVVEDQSIEVTMVTMEDKESDYLPKDLPESRVADKAFVGGHLV
AETTEHVVDFSTQIITEEKPEVSTAILDQITFNPLTSSQMIIGETEDQFIPDVKPEDHTA
KIDIEFGRSTVTISQVTTGDKETTYTPEIFPGEKAASMNIDLTHEIAETTATNVQDALGD
VESMKLDTVKAITSQEVFRSLQISQEIPQDKESIFEGKFKADVKDVKVTVEEGKGVTSVT
EITTEAKEGILDNLIHPEAREAVPALTSGHEVAEQTEVIADLLVGQVEALQTTPATAKIG
QKPYETVQLIEEFLGERESDRVDVKTVTSSAKVAVDEQSSVIVATTITQDVEEELLVPRK
PKEEIAKPGVESKEVAQQSEVMPKEGIEELLVTKPTEAAAKETQGTFESVNVIQAIPEEL
GSDFKGKFRPDERSADVSFVEGKSLTINEVMIQDKEGPVTIAKHIEGFAEVKLTRVGQDV
AQKTEVIVDQSTGSIAPFEIDSRKARPIQDTLESVIIEEVPAGETEGNFVDYPKTISSKI
TPTFEEGHSVSITEVTSGEREKVLEEQKLLESRTAETTVIMEHGSILTTVVDSSVDVKTE
VPVDERIPQTAIPSQDTFESVSVSENIIEESENSFEGQFKPTTQTAVIDIQEVKSFQVSE
TMSEYKEESFEGAPKIHTVQAKPEFSFLETVQKSQVEAIHSIGEVKDKTTITSQATMTQT
TMESVIETETMTSEREDTFEGKFKPEEHKGIAQMEGLSTVTIMEILSNEIEDTLAVDQKP
KDRKALPNITGREVAETMEVETIVGPEEFEKFKGPEGVKGKPQVDTLMSVVVSQTISNEV
EEFLPSPEVPLQKSVQPNLDYREIAQVSEVETILTVGDFVKMLSPEEKKGKPEVEEFAPL
TVSQVISHETEEEMPRPEKPSGQIAQPSLLGREIAETSEVETLLSTQKFIEDVAPEERKG
IFGLEEMTSLIVSQTVSGEVEEMLPGDEKPTTKTIQFDILGRDVAETSQVLTLASFDELE
HKRPGEQKGKPGFEEHSSVTVSQTISNEVEEELATPEVPSIRNAQPNLSGREIAESSEVE
TLLNAESLAKDKIPKEEQGKPALEEMTSLIVSQTISNEAEKLLPSEEIPSTKTAQSDIFG
HDIAQTSEVITMLSTGDFIRDAAPEEKKGQQSLEEMTSLIVSQTVSGESEEQLPGQEKPS
TKTAQPDIFGRDVAETTQVMTLNNFEELTEDKPVEQKSKPGFEELTSLTVSQVVSSEAEK
EMPSAEKPTTKTAESDILGYDIAETSQVLTMSSTGEFVKDTAPEEKRGQPSLEEMTSLII
SQTVSGESEEQLPGLEKPSSKTAQPDIIGHDIAETTQVMTLNNFEEFTEDKPIEQKSKPG
FEELTSLTVSQVVSSEAEKEMPSAEKPTTKTAHSDILGYDIAETSQIVTMSSTGKFVNDT
APEERKGQRSLEEMTSLIVSQAVSGESEQQLPGLEKPNSKTAQPDITGHDIAETSQVMTL
NNFEELTDEKPIEQKSKPGFEELTSLTVSQVVSSEAEKEMPNAEKPTTKTAESDILGYDI
AETSQVLTMSSTGEFF
NT seq 10671 nt NT seq  +upstreamnt  +downstreamnt
atggagaccgagcagccacacactcaccaaaaatatcaggtactttctagtcaacagatt
ccgcggttcattcaagagataactgacatttatacagaagctggtcaaaaggttgttttc
gaaacaatttattcaggacatccagctccagtcgtcgtatggttcaaagatgataaaatg
attgcaagtacaaagaacgtcaaggtgaaacttagtgaagaagaaaagaagacatcagtt
cttattttacatgctactcctgaggacgaaggaacttatgtttgcaaagctactagtgac
attggattagcaacaacgaaagctaaattacgagtatctggtacttatgaaactggcgat
gataactgggaggttgaagagcagccagaagaagttcctgaagaaaaaccgaagaggaag
aagagattggagatgaagagagctaaagaaactaaagagaaaatgaaagctcttaaagtt
agagttgaaaaaagaaaggatgcgctcaaggagaaagcaacggctagtgaacagcctgat
gataagagcatcgtagacgtggaagagacgcaagttctcgagtctacagacgtaattgaa
catgaagcttttgaaactactaaggcacatcgtgttatctcggtacaagagccagtaata
acggaagcaacagcttcattgaagaaagttgacgaaaaaacacaaaagattgtgccgaga
cgtgaagatcgagctcggccagttgttttagagcaagaggctttggtcgttggctcggaa
atagtcactcaagacacgacagctgactttaagatccaatctacgacagatcgtgctcaa
gttacttctgaaactttcgaaactgtctccgtatctgaagtccatactgagtcaagtgtc
caagagatcaagcggactgattctaagacacgaagagctaaaaagacggtagtgagtagc
caagaaggcgtcgttgaggttcgccagacgcaggttgaagaattccttgatgagaaaccg
aagaagaagaaagaccgaaaacgggatgtagttgaagttactattgaagaagtaatcaaa
gagcaaaaagttaatcttctaagagctgttgaagagattatggaactgctcaacgtcagg
gaattcggacctggtgaatctccgctacgtgaactcgctaccattggattcttagtcagc
catggagttccggttagtgaaataaatgaagctctctacagaactgaccaattcccagca
ttgagaactccagatgcacagaatgctctagtgcagttggtcgagagagaaggtcacggt
gcattgattactcaagttcttactgaagaaactacaacagacgaagctatcgttgctgct
actgttggtttccgagctttcatgagaatggtcgaacttattcacactactgttgaagaa
gtcattactcattttgctcccgaagactttcgtccaagagcatgggaggttactgaaatc
actgaggctgaagttgaggaacatatgactgaaagagtatccgtcgtccaaactacagag
gtccgcgtaatggaatacgaggacactcagctagtacacgaaacactgcacaaagaaata
aaaccagaagaacacgggtctcgagtggttgaggacacacaagaacaggatagggaaagt
attgatattgaggaggaaactgttgttactgagcgcgatgagggtagattagttaggaaa
aagccgaaaaaagagcaaagaagagagaaaaaagaagatgaagttgtggtagttgaggaa
gaagaaatagtaacgagaaaaattaagaaaccgcagaaaaaacagaaggaagaaatagag
attgagattgaggaagaagaaataattgaagaggaagaagaaggagagaaacgtaagaaa
atattgaaagccaaaagaccgaagaaaggcgaagaagaaattgatttcgaagaagttgaa
gattttgaaacggtaagagacaaagcagtgtcatctgtgcctgttaatacttcggtacag
agtcatgaagttgttgcgttaacgagaactgccgaacaagctcctggaaaaccggaaagt
gaaaaagctagagttactttggatacagtgaacgcattggtggaacaatatgtaccggtt
caagagagtgaagataaaattagcaaggtaaaaccagatgagaagaaagctttagtatcg
gtagctccagttgaacctttctctattacggaaacaactgttcagggctcgcatggagaa
tttaagggtacttttaagccaacaactttcgaagctacacctggatttgttacgaagcct
aaagaaagtcttcaagttacggaaacacttgcgaatgatgctaaaactactggattagat
ttgaagcaagctttgacgacgcaaaaagctgaagttgctttgactctacaggaagcgact
actgtaagtgaaactacggtaaaccaaggcgaagttcccactcaagactttgttgctccg
actgcagtgactgctgaagacacaatgctaccaaacatcagtctttctatttacgaagta
aacgaggctgttactgaagataaattggagcctactaagactatttctgctaagccacgg
gttaatataagtgctgtagaacctttgactattgaagaagtccaaactgaagacaagcct
ggaaagtattatccggaattatttgttccaactgaaatagcaacgacgacagtcgtgtca
cagaaacgtgttattactgaagagactcatgcaccggaaaaagagggagaatatgtgcct
ggaagattaccagctggtcagaaagctcaggttggtgtttctgaaggcggtgaagcgccg
atgattggagaacatccgatacaggaaatggaaggtgtctttgttcctggcaggaaagct
gacacttttgaagctgaaactaatgtcaatgttttggaaagcgttacggtttctacggtt
gagactcaacatcaagaagttaatcttgttgttgaagaagcgaagaaagctgtggctgat
ctgaatgttgttgagaagagttcagtatttactatggaaactgttacatctgaaagagaa
gtcgaatataaaccagaagagcaaccgtcagttaaaacagctgatagttcaatacttcct
ttagagatcggaagtatttccagtactattgtccaagagtctgagggtatatataatgaa
caagtgagaccaacatcagcaatcgcagaaaccagtctccgcccagaagaacacgtaacg
gtttctcaagtagagaccgctgatttgccgtctaaattcagcgaagatctgaagtacatc
acggaaagtggaactgtttctgtacaactgactgaagcgaaagtaatccaagagactttt
acgcatgatcgtgaagaaaagtttgaagactccgttaaaccggaagaaaaaatagtagat
atgatttatgattctgttaaaggtattgaaatatttcagacgacttccgtagacaaagaa
ggtcatttagaaatttatgagatgcctgagagccatcgaggtaaaatggttccaactcat
tctgtcatttccttccaggttgaggagactcaacctgaagataatgtagggaagcttgat
aaattagtcccaattactggaaaagctaaagttgggcatgataatttagttgaaactgtg
gtagatatcacagttgttgatgaagggttgaaacctgtagaaaaagatcaagtacctgag
tcaaagttcgctgaagttggattgaatgaagtagaaagtgtaaagacaacagaaattatt
gtgaacgaaactgaggaagattacagaagtgtcactaaaatggagagtgtgtttgcaaca
acaggtttcactacacaatctgctattgaattgcaagaagtgcgaactgaatcaccaact
ggagaaatacctgaagaagttcgtgcaagtggaactgctcaaacatctgcagtgccacta
gagtcagttactgttaatcttcaagaagttgctgaaaaagaagatatttatactgaagac
atcagacctgagtctaaaacagctagcattgattacactgaaacaagatcaggtgcaagt
gttctagaagttttgactcatgatctggagaacacgtatcgaccggatgagaaaccacga
gattttacggcttcgagttcgattgacagtcggacgatagctatgaaatctgaagtcctg
attgaacaaagtgcaggtaagatgtctgatgataaacctaagactgcgaaggcatttgga
actcaagaagcacttgatgagttggttgttgttgaaactaacattgcggagactgagaaa
ccgagatttgaagaagcaaaaccagttgaacaaaaagctcaagtcgatattacgacttca
gaaaatgtatcggtgatggaaatcacggcggttcatgctgaagagactttacatactgaa
gacgacgtctctgagaagacaattacaatgaacttaacgtcgactcatgaagtagcacaa
actgaagagacagttgttgccaataatattgattcactgtctgaagtaaaaccgaaaaca
gaaagcgctatattgcatcaaagtggcttagagatagttcagcagacagagttaacggtt
tcggagaaagaatcagtacttttggaagatgttaaaccggatttgaagaatgttaatgtc
agtttcacggaaggcgaaagtgtacaagtactattgacaaattcagaagacaaagaaggt
cgactagaagatcaagttaagcccaaaagctttgaggcatcaatagactttgaagttcaa
ggtgttgcttcgcagtatgaagtaatgagtgacactggagttagtgaatttacatcagaa
gttccaaaagacgcgaaaccatcagagactttacttctctatgaaactgcagtcgcggaa
gaaattcaaacgcgtgagactgaagctcctttgacggaaatccaaccgggcaatcgatta
gctgagttgttgttcgaaataggcgaaggtattctcgtgtctactgtggaaactggagac
aaagagagacctcttgaagaactcgagaaaccagaaaacaaatcagcaacctttgatttc
gaatcacatccagttgctgaagctttagagactattgctcaagatgatgcaggagagttt
aaaccagaagaaactcagtcagctactgcattaatggatcatgttgcacacaagagtata
gtaacaattgaaacatctgttggagatcgagaaggatttatggatgattttgttaagcct
gaagagaaagtcgttgatgttgcatttgaagaagctaagatctgtttgaatattacggaa
acaatttcatctgaaaaagagaaagagtatgtgggcaaagaagatgtgatgacagagaaa
gcaacgtttaacttcgatgctcataaagtagctgaacttactgaagtcacgacatcttca
ataactgatgaattgaaagaaaaggctccaacttcagcaattgctaaagaagaacgtcta
ccatttgaaggagttattcaaacagaagctgtgatctccgaaaaagaaaaagaattttct
gaaagtccaataattgctacaaacaaagcagacataataattggagataaaggaaatgtt
tcaagtgtttctgaagttatgatagttgacaaagagggctcactgaaaattcctgagaaa
ccggaagaacgaagagcttctatagacatgacaggacattcaatagctgagaaaattgaa
gttaatgttgactcaagtacgggagtctttggagaacttcaaaaggtatcagcttctgct
attccatcgcagattccactagagcctgtcgtacaaactgaaactcaaccatcagaatct
gaaggtttgttaacgaaagataaaaaaccaattaaagctcttgctgatttatctgtcgtt
gaagatcaaagtattgaagttaccatggtaacgatggaagacaaagaatctgattattta
ccaaaagatttacccgagagtagagttgcagacaaagcatttgttggtggacacttggta
gcagaaactactgaacacgtggtcgatttcagtactcaaattattactgaagaaaaacct
gaagtatcgactgctattttagatcagattactttcaatccattgaccagttctcaaatg
attattggagaaaccgaagatcaatttataccggatgtcaaaccagaagatcacactgct
aagattgatattgaatttgggcgcagcactgtaacaatttctcaagttactacaggcgat
aaagagaccacgtatacaccagaaatattccccggtgagaaagctgcttctatgaatatc
gatctaactcatgagattgctgaaacaacggctacaaatgttcaagacgctcttggtgat
gttgaaagtatgaaacttgatacagtaaaagcaataacgagccaagaagtttttagaagt
cttcaaatatctcaagaaattcctcaagacaaagaatcaatatttgagggtaagtttaaa
gcagatgtaaaagatgttaaagtgactgtcgaggaaggaaaaggagtaacaagtgttact
gaaattacaactgaagctaaagaaggtattcttgataacctaattcaccctgaagcacga
gaagctgtacctgctttaacttcaggtcatgaagtggctgaacaaacggaagtgatagct
gatttacttgttggacaagtagaggcacttcaaactactcccgctactgcgaaaattggt
cagaagccttacgaaacagttcaattaattgaagaattcctgggtgaacgagaaagcgac
cgcgttgatgtaaaaacggtaacatcaagcgctaaagtcgctgtagatgaacagagttca
gtaattgttgcaaccacgatcacacaagatgttgaagaagagcttctggttccaagaaaa
cctaaagaagaaatagcaaaacccggagttgagagtaaagaggtagctcagcagagtgaa
gtgatgccgaaggaaggtattgaagagctcttagtaacaaaaccaacagaagcagcagct
aaagagacacaaggaacatttgaaagtgtcaatgtcattcaagcaatacccgaagaactg
ggttcagactttaaaggcaagtttagacctgatgaacggagtgctgatgtttcattcgtc
gaaggcaagagtctgactattaatgaagttatgattcaagataaagaaggtcctgtaacg
attgccaaacacattgaaggctttgcagaagtaaagctgacaagggtgggacaagatgtt
gcacagaagactgaagttattgtcgatcagagcacaggatcaattgcaccgtttgaaatt
gattcaaggaaagctcgccctatacaagatacattagaatctgtgatcattgaagaagtt
ccagctggagaaactgaaggcaattttgttgattatcctaagactatttctagtaaaatc
actccgacgtttgaagagggacacagtgtatctatcactgaagtaacttctggcgagcgt
gaaaaagttcttgaagaacagaaattacttgaatctcgtacagctgagacaacggtgatt
atggagcatggtagtattttaacgacggtagtagactcaagtgtcgatgtgaagactgaa
gttcctgtagatgagagaataccgcaaactgctattccaagtcaagacacttttgaaagt
gtctcagtgtcagaaaatattattgaagagtctgaaaattcatttgaaggtcaattcaaa
cctactactcagacagctgtcatcgatattcaagaagttaaatcgtttcaagtatcagaa
acaatgtcagaatataaagaagaaagctttgaaggtgctccaaagattcatacagttcaa
gctaaaccagaatttagttttcttgaaactgtacagaaatctcaagtggaagcaattcat
agcatcggtgaagtgaaagataaaacgacaattacatcgcaggctactatgactcaaacg
accatggaatcagttattgaaacagaaacgatgacaagtgaaagagaagatacgtttgaa
ggcaaatttaaaccggaagagcataaaggcatagcacagatggaaggtcttagcacagtt
acaataatggaaattttatcaaatgaaattgaagatacgttggcagttgatcaaaagcca
aaggacagaaaagcattaccaaatatcacgggacgagaagtagccgagacaatggaagta
gaaactattgtgggtcctgaagagtttgaaaaattcaaagggcctgagggtgttaaaggc
aagccccaagtggatactttaatgtctgttgttgtctcgcaaacgatttctaatgaagtt
gaagagttccttcctagtcctgaagtacctttacaaaaaagtgtacagcctaatttggac
tatcgagagatcgcgcaagtgtctgaagttgaaacgatactaactgttggagattttgtt
aaaatgctaagccctgaagagaagaaaggtaaacctgaagtagaagagtttgctcctttg
acagtgtcacaagtaatatcgcatgagactgaagaagaaatgccacgtcctgaaaaacca
agtggacaaatagcccaaccaagtcttttaggtagagaaatagcagaaacttctgaagta
gaaactttgcttagtactcagaagtttatcgaagatgtggctccagaggaaagaaaagga
atttttggtctcgaagaaatgacttcgttgattgtatctcaaacggtatcaggtgaggtc
gaagaaatgcttcctggtgatgaaaagcctactaccaagaccattcaatttgacattctt
ggtcgtgatgttgctgaaacttcccaagttttaactttggccagttttgatgagcttgaa
cacaagagaccaggagagcaaaaaggcaaacctggttttgaagaacattcatctgttact
gtatcgcaaactatttctaatgaggtcgaagaagaattggctactcctgaagttccttca
attaggaatgcacaacctaatctttcgggtcgagaaatagctgagtcttctgaagtggag
acgcttctgaatgctgaaagccttgctaaagataaaataccaaaagaagaacaaggtaag
ccagctttggaagagatgacttcgttaattgtttctcaaacaatttcaaatgaagctgaa
aaattgttaccaagtgaagaaatacccagtacaaagactgcacagtctgatattttcggc
catgatattgctcaaacttctgaagttattacgatgctaagtacgggtgattttattaga
gatgcagctccagaagagaaaaaaggacaacaaagtcttgaagagatgacttctcttatt
gtatctcaaactgtgtctggagaatctgaagaacaacttccaggtcaagaaaaaccaagt
actaagacagctcagccagatattttcggtcgtgatgtagccgaaacaactcaagtgatg
actttgaataactttgaagagcttactgaagataagccggtagaacaaaagagcaagcca
ggctttgaagaattgacctcacttacagtttcacaagttgtttcaagtgaagctgaaaag
gaaatgcctagtgccgagaaacctactacaaagactgctgagtcagatattttaggttac
gatattgctgaaacatctcaagttttaacaatgtcgagtactggagaatttgtgaaagat
acagcccctgaggagaagagaggtcaaccaagtctcgaagagatgacttctcttattatt
tctcaaactgtatctggagaatctgaagaacagctaccgggtctagaaaaaccaagtagt
aaaacagctcaaccagatattataggtcacgatatagcagaaacaactcaagtgatgaca
ttaaataactttgaagaatttactgaagacaagcctatagaacaaaaaagcaagccaggc
tttgaagaattgacctcacttacagtttcacaagttgtttcaagtgaagcggaaaaagaa
atgccaagtgccgaaaaaccaactacaaagactgcgcattcggatatcttaggctatgat
atcgccgaaacatctcaaatagtgacaatgtcgagtactggaaaattcgtgaatgataca
gctccagaagaaaggaaaggtcaacgaagtcttgaagaaatgacttctcttatcgtatct
caagctgtgtctggagaatccgagcaacaactaccgggtctagaaaaaccaaatagtaaa
acagctcaaccagatattacaggtcacgatatagcagaaacatctcaagtgatgacatta
aataactttgaagaacttactgatgagaagcctatagaacaaaagagtaaaccaggcttc
gaagaattgacctcacttacagtttcacaagttgtttcaagtgaagctgaaaaggaaatg
cccaatgctgagaaacctactacaaagactgctgagtcagatattttaggttacgatatt
gctgaaacatctcaagttttaacaatgtcgagtactggagaatttttttaa

DBGET integrated database retrieval system