KEGG   Malus domestica (apple): 103402813Help
Entry
103402813         CDS       T03194                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
mdm  Malus domestica (apple)
Pathway
mdm03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103402813
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mdm03041]
    103402813
Enzymes [BR:mdm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     103402813
Spliceosome [BR:mdm03041]
 Complex C
  Other components
   Step II factors
    103402813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_30 T2SSE AAA_19 DUF2075 FtsK_SpoIIIE SH3-RhoG_link ATPase
Motif
Other DBs
NCBI-GeneID: 103402813
NCBI-ProteinID: XP_008339796
Position
16
AA seq 716 aa AA seqDB search
MAQGQGRPNNSMKSPNRQFSAGNGNGNVDALATKRKALAQHRKSLPIASVENRLIEEVRK
HDTLIIVGETGSGKTTQLPQFLFNAGFSGDGKVIGVTQPRRVAAMTVAKRVAEECGGNLG
QKVGYSIRFEDVTSSSTRIKYMTDGLLLREALLDPYLSRYSVIIVDEAHERTVQTDVLLG
LLKNVQDARSKSLNNLQNTKNQKTNDDMQSKENGAQGFRFLKQYQGRTPLKLIIMSASLD
AKIFSEYFGGARAVHIQGRQFPVDIFYTHHSIQDYLDASLTTILQIHLEEGPGDILVFLT
GQEEIESAERLVKERLKQLPENSQKLVAVPIYSSLSSEHQMRVFAPAPPGFRKVILATNI
AETSLTISGIKYVVDPGFVKARYYDPNKGLESLVVVPVSKAQALQRSGRAGREGPGKCFR
LYPEDQFGKLEDSTKPEIKRCNLSNVILQLKALGVDDITGFDFIEKPSRSAIVKSLEQLF
VLGALTDDCKLSNPVGIQMARLPLDPIYSKALIVASEFNCLEEMLISVAMLSVESIFFNP
RDKIEEVRTAQKSFASPEGDHLTLVNVYRASNEFLEKRSGLSKEKREKAFRKWCKDNFIH
SRSLTNARDIHRQIRGHVEQMGLRITSCGDDVLQFCRCLAASFFLNAALKQPDGTYRALA
NGEVVSIHPSSVLRNRPECLIYNELVETSRKFIRNTTRIDFLWLTELAPQFYAMQN
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggccaaggacggccgaacaactccatgaaaagccctaaccgccaattctcc
gccggcaacggcaacggcaacgtcgatgccctcgccaccaagaggaaagcgctcgcgcag
cacaggaagtccctcccaatcgcttctgttgaaaatcggctaatcgaggaggttcggaag
cacgatactttgattattgttggcgaaacgggaagcggaaaaacaacacaattacctcag
tttttgttcaatgctgggttttccggggacggaaaagtcattggggtaactcaacctagg
cgtgtggctgcaatgactgtggcgaagcgggttgctgaggaatgtggcggtaatttgggt
cagaaggttggttactccattagattcgaggacgtgacttctagttcaacacggatcaag
tacatgacagatggattgctactgagggaagcactattggatccatatctctctaggtat
tcagttataattgttgatgaagctcatgagagaactgtccagacagatgtgctactaggc
ttgctgaaaaatgtacaagatgcaaggtcaaaatccctcaacaacctccagaatactaaa
aaccagaaaacaaacgatgacatgcagtcgaaagaaaacggtgctcagggcttccgtttt
ctcaagcaataccaaggaaggaccccgttgaagttaatcatcatgtccgccagcttggat
gcaaaaattttctctgagtacttcggtggtgcaagagctgttcacatccaagggcgacag
tttcccgtggatatattttatacacatcattctatacaagattatcttgatgcttcgtta
accacaatattgcagattcacctggaggagggccctggtgatatacttgtatttttgacg
ggtcaagaagaaattgaatctgcagaaagacttgtcaaagaaagacttaaacagttacca
gaaaacagtcaaaaactagtagctgttcctatatactcatctctttcatcagaacatcaa
atgcgagtttttgcaccagcccctcctggatttcgtaaggtaatattggcaacaaatatt
gctgagacatcattgacaatatctggaatcaagtatgttgtagatcctgggtttgtaaaa
gcacgttactatgatccaaacaaagggttggaatcattggttgttgttccagtttcaaaa
gcacaggctcttcaaaggagtgggcgtgctggaagagaaggaccggggaaatgcttccgc
ctctacccagaagatcaatttggcaaacttgaggattcgacaaagccagagatcaagcga
tgcaacctctctaatgtcattttgcaacttaaggcgctgggtgttgatgatatcactggg
tttgacttcatagaaaaaccgtcgaggtcggctattgtcaaatcactggagcaattgttc
gtactgggtgctttgacagacgactgcaaattgtcaaatccagttggaatccaaatggct
cgccttcccttagaccctatttattcaaaggctctaatcgtagcaagtgaattcaattgc
ctggaagagatgttgataagtgttgcaatgctttcggtggaatcaatattttttaatccc
cgtgacaaaatagaagaggtgagaactgcgcagaaatcctttgcaagtccagagggagac
cacctcactttggttaatgtatatcgagcatccaatgagttcttggagaagagatcaggt
cttagtaaagagaagcgtgaaaaagccttccggaaatggtgcaaggataatttcattcat
agtcgctccttgacaaatgctcgtgacattcacagacaaattcgagggcatgttgaacaa
atgggtctccgtatcacctcttgtggggatgatgtgcttcagttttgcagatgtcttgcc
gcttctttcttcctcaatgcagctttaaagcagcctgatggaacatacagggctttagca
aatggtgaggtggtttctatccacccgtcttctgtgttaagaaatagaccagagtgccta
atttacaatgaactggtcgaaactagtagaaaattcatccgcaacacaactagaatcgac
tttttgtggttaactgagcttgctcctcaattctatgccatgcagaattga

DBGET integrated database retrieval system