KEGG   Malus domestica (apple): 103403670Help
Entry
103403670         CDS       T03194                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00970  Aminoacyl-tRNA biosynthesis
mdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103403670
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mdm03029]
    103403670
Enzymes [BR:mdm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     103403670
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     103403670
Mitochondrial biogenesis [BR:mdm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    103403670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N Hormone_6
Motif
Other DBs
NCBI-GeneID: 103403670
NCBI-ProteinID: XP_017179045
Position
16
AA seq 318 aa AA seqDB search
MQLLPPPPSSVDPTLLLLPSCLSSCESCSNGPTASLNSEPTYNFFDEAQPLHCLISSWVT
KMASTIFRSLHTNPCLLHTTALLRRKDVILYCTMRSAQTRTAATQDKVKPQVKVAPNIQN
KTLEKASKDYEAVIGIETHVQLNTLTKAFCSCPYNYGSLPNTSVCPVCMGLPGALPVLNM
KVIESAVKVGLSLNCKLSFNSKFDRKQYFYPDLPKGYQISQFDVPIATGGYIDVDLPLEY
GGGHRKFGITRVHMEEDAGKLLHSEGGSYSQVDLNRAGVPLLEIVSEPDMRTGIEAAEYA
AELQRLVRYLGTTQSDNA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgcttccgcctcctccttcctctgtcgaccctactcttcttcttcttccctct
tgtttaagcagctgtgagagctgctccaacggtccaaccgcgagtctcaactctgaacca
acctataacttcttcgacgaagcacagcccttgcattgtttgatatccagctgggttacg
aagatggcttccacgatctttagaagccttcatacgaacccttgtttgctccatacaact
gcactacttagaagaaaagatgtcattttgtattgcacaatgaggagcgcacaaacccgg
acagccgctacacaagataaggttaagccgcaagtgaaagtagcaccgaatattcagaac
aaaacactcgagaaagcctcaaaggactatgaagcagtcataggtatagaaactcatgtc
cagctcaacactcttaccaaggccttttgtagttgcccttataattatggctctctaccg
aacactagcgtctgccccgtatgcatgggtctgcctggtgctttaccggttttgaacatg
aaggtcattgagtctgcagttaaagtcgggctttcactcaattgcaaattgtcattcaac
tcaaagtttgataggaaacagtacttttacccggaccttccgaagggttaccaaatatca
cagtttgatgttccaattgcyactggtggctacattgatgtggatcttcctttggagtat
ggtggcgggcataggaaattcggcattacaagagttcacatggaagaggatgcagggaag
ctgcttcattcagaaggtggaagttactcacaggttgatttaaacagagccggggtgcct
ttgcttgagattgtttctgaacctgatatgagaactggtattgaagctgcagaatatgct
gcagaattacagaggttggttcggtacttgggaacaacacaatcagacaatgcttaa

DBGET integrated database retrieval system