KEGG   Malus domestica (apple): 103404083Help
Entry
103404083         CDS       T03194                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37e
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mdm  Malus domestica (apple)
Pathway
mdm03040  Spliceosome
mdm04141  Protein processing in endoplasmic reticulum
mdm04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103404083
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103404083
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103404083
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mdm01009]
    103404083
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mdm03041]
    103404083
   03009 Ribosome biogenesis [BR:mdm03009]
    103404083
   03110 Chaperones and folding catalysts [BR:mdm03110]
    103404083
   04131 Membrane trafficking [BR:mdm04131]
    103404083
   03051 Proteasome [BR:mdm03051]
    103404083
   03029 Mitochondrial biogenesis [BR:mdm03029]
    103404083
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdm04147]
    103404083
Protein phosphatases and associated proteins [BR:mdm01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103404083
Spliceosome [BR:mdm03041]
 Complex B
  Other components
   Prp19 complex
    103404083
 Complex C
   Prp19-CDC5 complex
    103404083
Ribosome biogenesis [BR:mdm03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103404083
Chaperones and folding catalysts [BR:mdm03110]
 Heat shock proteins
  HSP70 / DNAK
   103404083
Membrane trafficking [BR:mdm04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103404083
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103404083
Proteasome [BR:mdm03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103404083
Mitochondrial biogenesis [BR:mdm03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103404083
Exosome [BR:mdm04147]
 Exosomal proteins
  Proteins found in most exosomes
   103404083
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl
Motif
Other DBs
NCBI-GeneID: 103404083
NCBI-ProteinID: XP_028952450
Position
16
AA seq 397 aa AA seqDB search
MILWEEKLEPPEEDLLLVSVPLSWTLTGVLAATTRRFDDVSSPLISEAMAVRAVWSRQAV
AIAQAVGRDDSHERNDMVSHMHTVKQRFTSCIGVWQHDRVEIIANDQGNRTTPSYVAFTD
TERLIGDAIKNQVAMNPINTVFDAKRLIGRRVTDASVQSDMKLWPFKVTSGPGDKRMIGV
FYKEEDKLFAAEEISSMVLIKMHEITEAYLGSTIKNAVVTVPAYFNNSQRQATKDAGVIA
EINVLHIINEPTAAAIAYGLDKKATNVGEKNVLIFDLRGGTLDVSLLTIEKGIFEVKATT
NDTQLGGEDFDNRMENHFVQEFKRKNKKDISGNPRALRRLMTSYERAKRTLSSTAQTTIE
IDSLYKGIDFYSTITRARFEELNVDFSGSVWNQSRSV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgatactttgggaggaaaaactggaaccacctgaggaagacttgttgctggtttcggtg
ccattatcatggactttaacgggtgttttggctgctactactagaagatttgatgatgta
tcctccccattgatctcggaagctatggcagtaagggcagtgtggtctcgtcaagctgtt
gctattgcacaagcagtgggacgtgatgacagccatgaaagaaatgatatggtctctcat
atgcatactgtaaagcaaagattcacatcatgcatcggtgtctggcaacacgaccgtgtt
gagatcattgccaacgaccagggtaacagaaccaccccgtcgtacgtcgcttttactgat
accgagcggttgatcggagatgccatcaagaatcaagtcgccatgaaccctattaacacc
gtcttcgatgctaagcggttgattggtcgtagagttaccgatgcctctgtccagagcgac
atgaagttgtggccattcaaggttacctccgggcccggtgacaagcgcatgattggagtc
ttttacaaggaagaagataagctcttcgccgctgaggaaatctcctccatggtccttatc
aagatgcatgagatcaccgaggcctaccttggcagcaccatcaagaacgctgttgtcaca
gttcctgcctactttaacaactcccagcgtcaagcaaccaaggatgctggagttattgcc
gaaatcaatgtcctccatatcatcaatgagcccactgctgccgccattgcttatggcctt
gacaagaaggccaccaacgttggtgagaagaatgtcttgatcttcgatcttagaggtggt
accttagatgtgtctcttctcaccattgagaagggtatctttgaggttaaggccacaacc
aatgacacccagttgggaggagaagattttgataacagaatggaaaaccacttcgttcag
gagttcaagaggaagaacaagaaggatatcagtggcaaccccagagcactcaggaggttg
atgacatcctatgaaagggcaaagagaaccctctcttccaccgcgcagaccaccatcgaa
atcgactccctttataagggtattgatttctactccaccatcacccgtgctagattcgag
gagttgaacgtggatttttcaggaagtgtatggaaccaatcgagaagtgtttga

DBGET integrated database retrieval system