KEGG   Malus domestica (apple): 103408443Help
Entry
103408443         CDS       T03194                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
mdm  Malus domestica (apple)
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdm01001]
    103408443
Enzymes [BR:mdm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103408443
Protein kinases [BR:mdm01001]
 Serine/threonine kinases: TKL group
  IRAK family
   103408443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH ABC1
Motif
Other DBs
NCBI-GeneID: 103408443
NCBI-ProteinID: XP_028950077
Position
2
AA seq 454 aa AA seqDB search
MRMYGFELGFERPYAIRCQGKYWTGNYVSTCFPQTISGFFQFLWQQISHERIWLPGKLSS
LLHNNYIVRGWVIVICIGLLFLAKIIFGVPVVTAFLIYRWRRRHLSMYSTIEDFLQCDNN
FMPIRYSYSDIKKMTRRFKHKLGEGGFGTVFKGKLRSGRFVAVKVLGKPKANGQDFISEI
ATIGRIHHANVVQLVGYCVEGSKRALVYDFMPNGSLDKYIYSKEGSLPLTIKNMYEISLG
VAQGIEYLHQGCEMQILHFDIKPHNILLDQNFKAKVSDFGLAKLYPIDNSIVPLTAARGT
LGYIAPELFYKNIGGVSYKADVYSFGMLLMEMASRRKNWNARVEHSSQNYFPVWVYDQYI
VGNDLEMDNVTEEEKKVIRKMVITALWCIQMKPSDRPSMSKVVKMLGGDVECLQMPLRPS
LCPQETPVTVGNIQVNKSNPICSNVELTCSLSAR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatgtatggcttcgagcttggatttgagaggccttatgcaatacgctgccaaggc
aaatattggaccgggaattatgtgtctacatgttttccgcagaccatttcaggtttcttt
caatttctgtggcagcaaatcagtcatgaaaggatctggttgcctggcaagttgagttca
ttgttacacaacaactacatcgtacgtggatgggttatagtcatatgcatcgggttactt
ttcctagccaaaataatttttggagttccagttgtgactgcatttttaatctatagatgg
cgcagaaggcatttgtctatgtatagcacaatagaagattttctacaatgcgataacaac
ttcatgcctataaggtactcttactcggacatcaagaaaatgactcgcaggttcaagcac
aagttgggtgaaggtggctttggcactgtatttaaaggaaagctccgcagtggccgtttt
gtagcagttaaagtcttgggcaagcccaaagctaatggtcaagattttattagcgaaata
gctacgatcggaaggattcaccatgctaatgtggtgcaacttgttggatattgtgtcgag
ggatcaaagcgcgctctagtatatgacttcatgcctaatggctctcttgataaatacatt
tattccaaagaaggaagtcttcccttgactatcaagaacatgtacgagatttctcttgga
gtggctcaagggattgaatatctacatcaaggttgtgaaatgcaaattctacatttcgac
atcaagcctcataacattcttcttgatcagaactttaaagcaaaggtttctgactttggg
cttgcaaaattgtatcccatagataatagcattgtccctttgacggcagcacgaggtacg
ttggggtatattgctcctgagttgttctacaaaaatattggaggcgtctcatacaaggca
gatgtctatagttttggaatgttgttgatggaaatggcaagcagaaggaagaattggaat
gcaagggtagagcattcaagccaaaactacttcccagtgtgggtgtacgatcagtatata
gtgggaaatgacttagaaatggacaatgttacagaggaggaaaagaaagtaataagaaag
atggttataaccgccttgtggtgtattcaaatgaaaccaagtgatcgcccttcgatgtcc
aaagttgtcaaaatgcttggaggagatgttgaatgtctgcaaatgcctctcaggccttct
ctatgcccacaagagacgcctgtgactgtgggcaatattcaagtcaataaatcgaaccca
atatgttctaatgtggagctaacatgttcattgtcagctaggtga

DBGET integrated database retrieval system