KEGG   Malus domestica (apple): 103417357Help
Entry
103417357         CDS       T03194                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 3, peroxisomal-like
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00071  Fatty acid degradation
mdm00592  alpha-Linolenic acid metabolism
mdm01040  Biosynthesis of unsaturated fatty acids
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
mdm01212  Fatty acid metabolism
mdm04146  Peroxisome
Module
mdm_M00087  beta-Oxidation
mdm_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103417357
   00592 alpha-Linolenic acid metabolism
    103417357
   01040 Biosynthesis of unsaturated fatty acids
    103417357
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103417357
Enzymes [BR:mdm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     103417357
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 103417357
NCBI-ProteinID: XP_008353771
Position
17
AA seq 284 aa AA seqDB search
MTFASNYLKMIYVKRTPESSKTIHVVSSAFKALHTWHNMRTLQECREACGGQGIKTENRV
GHFKGEFDVQSTFEGDNNVLMQQVSKALLAEYIATQKRGKPFKALGLEHMNKPCPVIPSQ
LTSSTLQCSQFQMDAFCLRERDLLNRFAMEVSQRQKQGESKEYSIILSYQLAGDLGRAFA
DRSILQTFIDAEAALPAGSLKNVLALLRSMYALICLEEDAAFLRYGYLSTNNVAAVRKEV
SRLCGELRPHALALVSSFGIPDAFLSPIAFNWIDSNSWSSVEQH
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgacttttgcttcaaattacttaaagatgatttatgttaagaggacgcctgagtcgagc
aaaaccatccatgttgtttctagtgcatttaaggctctacatacctggcataacatgcgg
actcttcaggaatgccgcgaagcctgtggagggcaaggtatcaagactgaaaaccgtgtt
ggtcattttaaaggtgaatttgatgtgcagtccacttttgagggggacaacaatgttttg
atgcaacaggtcagcaaagcactgcttgcagagtatatagcaactcagaagagaggcaaa
ccatttaaagctttgggactagagcatatgaataaaccttgccctgtcattccatctcaa
cttacaagttctaccctccagtgtagccaattccagatggatgctttctgcttaagagag
cgagatctgttgaatagatttgctatggaagtgtcacaacgtcaaaaacagggagaaagc
aaagagtactcgatcattcttagttatcagcttgcaggggacctgggcagagcttttgca
gatcgatcaatattgcaaaccttcatagatgctgaggcggcactacctgctggttcatta
aagaatgtcttagctctgttgaggtctatgtacgcattgatttgcttggaagaagatgcg
gcattcctccgatatgggtacttatcgaccaataatgtcgctgctgtgaggaaagaagta
agcagactgtgtggtgaattgcggccgcatgcactggccttggtgagttccttcggcatc
cccgatgcttttctgagtcccatagcttttaactggatcgattcaaattcgtggtcttca
gttgagcagcactag

DBGET integrated database retrieval system