KEGG   Malus domestica (apple): 103417780Help
Entry
103417780         CDS       T03194                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00010  Glycolysis / Gluconeogenesis
mdm00562  Inositol phosphate metabolism
mdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103417780
   00562 Inositol phosphate metabolism
    103417780
Enzymes [BR:mdm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     103417780
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     103417780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 103417780
NCBI-ProteinID: XP_008354159
Position
1
AA seq 493 aa AA seqDB search
MGRAMAALLLVLLSVFVHSNAGEEGFDVRQHLSTASRYGVVKDIADNSFVPSKIPDGCTP
IHLNLVARHGTRAPTKKRIKDMDILASRLEVLLKEAEEQNLSLEKLPGWFLGWKSPWKGK
LTGGELIVQGEDELYDFGIRTRERFPNLFDQDYHPDVYTIKATQVPRASASAVAFGMGMF
SGKGNLGPGRHRAFAVSSESRASDIKLRFHDCCQNYKAYKKSQEPSVDKLKEPIYDEITS
SLRRRYKLNFTKKDTTSLWFLCKQEASLFNITGQACALFTPSEVSLLEWADDLEAFILKG
YGKSLNYRMGVPLLEDVLLSMEQAITAEEEKHAPGSYEKARLRFAHAETVVPFSCLLGLF
LDGTEFERTQKEQPLQLPPKPPQKRKWRGNTVAPFGGNNMLVLYSCPANISSKYFVQVLH
NEHPIPMPGCDGSDFCPLDVFKERIVAPHLKHDYNSVCNAKLEEKEAKPASKLSQLFRWL
FSLGNGDKTLDEL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggggagagccatggcggcgcttctgctggtattgttatcggtgttcgtccattcgaat
gccggagaagaaggtttcgatgttcgccaacatctttctactgcgtccagatacggtgtc
gttaaagacattgcggacaactcatttgtaccatccaagataccagatgggtgtactcct
atccacctaaatcttgtggcaaggcatggaacccgtgctcctaccaaaaaacgtatcaaa
gatatggatatcctggcctctcgtctggaggtgctactaaaagaagcagaagaacagaac
ctatctttggaaaaacttcctggttggtttttgggttggaaatctccttggaaaggaaaa
ctgacaggtggagaattaattgtccaaggagaggatgaactctatgattttggaatcagg
acacgagaaaggttcccaaatctgtttgatcaggattaccatccagatgtttacacaata
aaggcaacacaggtccctcgggcatccgccagtgctgtggcatttggcatgggaatgttt
agtgggaaaggaaatcttggacctgggcgtcatcgagcttttgctgtgtccagtgaaagt
cgtgcgagtgatataaagttgaggtttcatgattgttgccaaaactacaaggcatataag
aaaagtcaggagccttctgttgacaagctcaaggaacctatctatgatgaaattacttct
tcattaaggaggcgctacaagttgaattttacaaagaaggatacaacttctctttggttt
ctttgcaaacaggaagcgtccttgtttaatataactggtcaagcttgtgcgctgttyacc
ccttccgaggtttctttgctggagtgggcagatgatttggaagcctttatattaaaggga
tatggtaaatcattaaactatagaatgggagttcccttgcttgaagatgtattgctgtcc
atggagcaggctattacggctgaagaagaaaaacatgctcctgggagttatgaaaaggca
aggctaaggttcgcacatgcagaaactgtagttccattttcatgcctgcttggacttttt
cttgatggaactgaatttgaacggacacagaaggaacaacccttgcaactccctccaaag
cctccccagaagagaaagtggaggggcaatactgtggcaccttttggcgggaataatatg
ctggttctgtacagttgtccagccaacatttcaagcaagtactttgtgcaagtgctgcac
aatgaacaccccattccaatgccaggctgtgatggttctgatttctgtccactcgatgtt
ttcaaggaaagaatagttgctcctcatctgaagcacgactataactcagtgtgcaatgca
aaattggaggaaaaggaggcgaagccagccagtaagttatctcaactgttccgttggttg
ttctcactggggaacggtgataaaaccctcgatgaattgtag

DBGET integrated database retrieval system