KEGG   Malus domestica (apple): 103417932Help
Entry
103417932         CDS       T03194                                 

Definition
(RefSeq) phosphoenolpyruvate carboxykinase (ATP)-like
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00010  Glycolysis / Gluconeogenesis
mdm00020  Citrate cycle (TCA cycle)
mdm00620  Pyruvate metabolism
mdm00710  Carbon fixation in photosynthetic organisms
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
mdm01200  Carbon metabolism
Module
mdm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
mdm_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103417932
   00020 Citrate cycle (TCA cycle)
    103417932
   00620 Pyruvate metabolism
    103417932
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103417932
Enzymes [BR:mdm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     103417932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_24 AAA_16
Motif
Other DBs
NCBI-GeneID: 103417932
NCBI-ProteinID: XP_008354307
Position
1
AA seq 675 aa AA seqDB search
MASNGNGEFSFASGNGTVATAANGNGTARNGLAKIQTQKKDNGVCHDDSTPPVKAQTIDE
LHSLQKKKSAPTTPIKGTQGGAFAVTLSEEERQKQQLQSISASLASLTRETGPKVVRGDP
AKQSDTPKVSSHVSHHHHFTPTISVSDSALKFTHVLYNLSPAELYEQAIKYEKGSFVTST
GALATLSGAKTGRSPRDKRVVKDDTTRDDLWWGSGSPNIEMDEHTFMVNRERAVDYLNSL
DKVFVNDQFLNWDPENRIKVRVVSARAYHSLFMHNMCIRPTPEELENFGTPDFTIYNAGQ
FPCNRYTHYMTSSTSIDLNLARREMVILGTMYAGEMKKGLFSVMHYLMPKRQILSLHSGC
NMGKDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWTENGVSNIEGGCYAKCIDLSRE
KEPDIWNAIKFGAVLENIVFDEYTREVDYSDKSVTENTRAAYPIEYIPNAKIPCVGPHPK
NVILLACDAFGVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIM
LHPTKYAAMLAEKMQKHGATGWLVNTGWSGGSYGSGKRIKLPYTRKIIDAIHSGSLLNAK
YKKTEVFGLEIPTEVEGVPSEILDPMNTWSDKNAYNETLMKLAGLFKRNFETFTNYKIGK
DNKLTEEILAAGPNF
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaatgggaacggagagttcagctttgcgagcggaaacggaacggtggcaacg
gcggcaaacggtaacggaacggcgaggaacgggctggcgaagatccagacgcagaagaag
gacaatggagtgtgtcacgacgacagtacgccacctgtgaaggcgcagacgatcgacgag
ctccactcgctgcagaagaagaagtcggcacccaccaccccaatcaagggcactcagggt
ggtgcctttgccgtcaccctctctgaggaggagcgacaaaagcagcagctccagtccatc
agtgcatctttggcatcgctgacgagagagacgggaccaaaggttgttcgaggagacccg
gccaagcagtccgatacccccaaggtttcgtcgcacgtgtcgcaccaccaccacttcacg
cccaccattagcgtcagtgacagcgccttgaagttcacacatgtcctctacaacctttct
ccagctgagttatatgagcaggcaataaagtatgagaaagggtcgttcgttacgtcaacc
ggcgcgctagcaactctttctggagccaagactggtcgctctccaagagacaaacgcgtc
gtcaaggatgacaccacccgggacgacctttggtggggaagcggctcacctaacattgaa
atggacgagcatacgttcatggtcaacagagaaagagctgtggattacttgaattctttg
gacaaggtctttgtaaatgatcaatttttgaattgggatccagaaaacagaatcaaagtt
cgggtcgtgtctgccagggcttatcactcattgtttatgcacaacatgtgtatccgaccc
actcctgaagagctggagaattttggtactccggacttcactatatacaatgccggccag
ttcccatgtaatcgttacacccactacatgacatcctctactagcatagaccttaatctt
gctaggagggaaatggtcatcctcggcaccatgtacgctggggaaatgaagaaaggtctt
ttcagtgtcatgcattatctcatgcctaagcgacaaatcctatccctgcattctggctgc
aatatggggaaagatggagatgttgcccttttctttggattgtcaggtactggaaagacg
actctgtctacggatcacaataggtacttgattggagatgatgaacactgctggactgag
aacggtgtgtcaaatatcgaaggtggttgctacgccaagtgcattgacctgtcaagggag
aaagaacctgatatttggaacgccatcaagtttggcgctgtgttggaaaacatcgtgttt
gatgagtatacacgagaggtggactattctgacaaatctgttacagagaacactcgtgca
gcttatcccatcgaatacattcccaatgcaaagataccatgcgttggtccacatccaaag
aatgtcatacttttggcatgcgatgcatttggtgtgctccctcctgtgagcaagttaaac
cttgctcagaccatgtaccacttcatcagtggctacactgctctggttgctggaactgaa
gatggtatcaaggagccaacagcaacattctcagcatgcttcggtgcagcatttataatg
ttgcatcctactaagtatgcagcaatgctggctgagaagatgcagaagcacggtgcaaca
ggatggctggttaacactggctggtccggtggaagctatggatccggaaagcgcattaag
ttgccctacaccaggaaaatcattgacgccatccactccggcagcctcttaaatgcgaag
tacaagaagactgaagtgtttggacttgaaatccccactgaggtcgagggagtgccttca
gaaatactggatccaatgaacacttggtcggacaagaatgcatacaatgaaactctgatg
aagctagctggcctcttcaagaggaactttgagactttcacaaactacaagattgggaag
gacaacaagctgaccgaggagatacttgcggccggaccaaatttctaa

DBGET integrated database retrieval system