KEGG   Malus domestica (apple): 103419668Help
Entry
103419668         CDS       T03194                                 

Definition
(RefSeq) internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
mdm  Malus domestica (apple)
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103419668
Enzymes [BR:mdm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     103419668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 103419668
NCBI-ProteinID: XP_008355989
Position
5
AA seq 549 aa AA seqDB search
MAFERISRTARHGFRRSPSGASSRTTEKDMLCERASTXKYCSVPSLEREXRNNNLSYLSS
ISKVNHNSFWSRGISITPXYQFPSAERIVEESDSECNDPKYPGLEATRPSEKPRVVVLGT
GWAACRFLKGLDTKVYDVVCISPRNHMVFTPLLASTCVGTLEFRSVAEPVSRIQSALAAS
PSSYFYMASCVGLDTDKHEVYCETISNGGLSHEPYRFKVAYDKLXIAAGAEPLTFGIKGV
KEHAFFLREVNHAQEIRKKLLLNLMLSEHPGISEEERKRVLHCVVIGGGPTGVEFSGELS
DFIMKDVQERFSHVKDYIKVTLIEANEILSSFDXGLRQYATNHLTXVGVRLMRGVVKEVH
PKKIVLNDGTDVPYGLLVWSTGVGPSEFVKKLXLPKSPGGRIGVDGWMRVPSVEDVFALG
DCAGFLEETGRPVLPALAQVAEREGKYLVELFNRIGKQDAGKAFSAKDIPLGEQFVYKHL
GSMATVGGYKALVDLRQSKDAKGISLAGFLSWLIWRSAYLTRVVSWRNRFYVAVNWATTL
VFGRDNSRI
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaaaggatttctaggactgctcgacatggattcagaaggtcgccatcagga
gcatcttcgcgcacaactgagaaggatatgttgtgtgagcgagcatccacackcaaatat
tgctccgtaccttcactcgaaagggagamgagaaacaacaatctttcgtayctctccagc
atttcaaaggtgaatcacaatagtttctggagcaggggaataagcataaccccgarttat
caattcccttctgcggaaaggattgttgaggagtcygattcggagtgyaatgaccccaag
tatccgggactagaagcaaccaggccgagtgaaaagccaagagtggtggtycttggtact
ggctgggctgcatgtcgattcctcaaaggactagacaccaaggtttatgatgttgtttgc
atatcgccgagaaatcacatggtcttcactcctttgcttgcttcaacttgcgttggtacc
ctggaatttcgctcggtagctgaacctgttagtcgtatacaatctgcattggcagcgagt
cccagttcatacttttacatggcttcctgcgtcggccttgacactgacaaacatgaggtt
tactgtgagacaattagcaatggcggtttatctcatgaaccttacaggttcaaagtagcg
tatgacaaactcrtcatagctgccggagctgaaccyctgacgtttggcatcaagggtgtg
aaggaacatgcatttttcctccgcgargtgaatcatgcccaagagattaggaagaagctt
ctcttgaacctcatgctttcggaacatccaggcatatcggaggaagaaaggaaacgcgtc
ctgcattgtgttgttattggaggtggccctacaggggtggagttcagtggcgaattgagc
gatttcatcatgaaagatgtacaagaacggtttagtcacgttaaggattacatcaaagtc
actctcattgaggcgaatgagattttgtcatcgttcgatrttgggttaaggcaatacgca
acaaatcacttgaccarggttggsgttcgccttatgcgaggcgttgtgaaagaagtgcat
ccgaagaagatagttctcaacgatggcactgatgttccatatggccttttggtctggtct
accggcgttggtccctcagagtttgtgaaaaaactcgrtcttccaaagtccccrggcgga
aggattggtgtcgatgggtggatgcgggttccttcagtggaagatgtgtttgcactggga
gattgtgccggttttctygaggagacggggaggccagtccttccsgctttagctcaggtg
gcagaaagggaaggaaagtatctggtggagytgtttaacaggattgggaagcaggatgcc
gggaaggccttcagcgcgaaagacattcctctcggggagcaatttgtgtacaagcaccta
ggaagcatggcaacagttggaggctataaggctttggttgatctgcgccagtctaaggat
gcaaagggcatatcccttgccggatttctcagctggttaatttggcgctccgcttatctg
acgcgtgttgtcagctggaggaacaggttctatgttgcagtgaactgggccactactctt
gtatttggcagagataactcaagaatatag

DBGET integrated database retrieval system