KEGG   Malus domestica (apple): 103422791Help
Entry
103422791         CDS       T03194                                 

Definition
(RefSeq) non-specific phospholipase C1-like
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00562  Inositol phosphate metabolism
mdm00564  Glycerophospholipid metabolism
mdm00565  Ether lipid metabolism
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103422791
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103422791
   00565 Ether lipid metabolism
    103422791
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:mdm02042]
    103422791
Enzymes [BR:mdm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     103422791
Bacterial toxins [BR:mdm02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   103422791
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-GeneID: 103422791
NCBI-ProteinID: XP_017184269
Position
11
AA seq 383 aa AA seqDB search
MAFRRKRIIWTLFFFHLLLVSTQFIAARKTPKIKGPIKTVVVVVMENRSFDHIFGWLKST
RPDIDGLNGNESNPIFVSEPGSPRVRVSSDAFFVDSDPGHSFQAIREQIFGSNESSENPA
PMNGFAQQAESMGEGMARTVMSGFKPEVLPVYTELANEFAVFDRWFASVPASTQPNRFYI
HSATSHGAMSNVRKDLIHGFPQKTIFDSLDENDLDFGIYYQNIPATLFFKSLRKLKHVTK
FXSYALTFKRHAQLGKLPNYAVIEQRYFDVKELPANDDHPSHDVARGQRFVKEVYETLRA
SPQWKEMALLITYDEHGGFYDHVPTPVXDVPSPDGIVGNEPYYFRFDRLGVRVPTILVSP
WVEXGTGEFSASRFFQXVFFFXF
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggctttccggcgaaaacgcatcatctggactctctttttcttccacctcttgttggtc
tccacccaattcattgcggcacgcaaaacgcccaaaatcaaaggacccattaaaacggtg
gtcgtcgtggtcatggaaaaccgctcctttgaccacatcttcggctggcttaagtcgacc
cgacctgacatcgacggcctgaacgggaacgaatcgaacccaattttcgtctcggaaccc
ggctcgccccgagtccgagtctccagcgacgccttcttcgtcgactccgacccaggccac
tcgttycaggcgattcgagaacagatattcgggtcgaacgagagctcygagaacccggct
ccgatgaacgggttcgctcagcaggcggagagtatgggcgaggggatggcgagaacggtg
atgagcgggtttaagccggaagtcctcccggtctacaccgarttggctaacgagttcgcc
gtgttcgaccgrtggtttgcttccgtaccggcgtcaactcagccgaaccggttctacatc
cactcggccacgtcacacggcgccatgagcaacgtccgcaaggacctcatccacggcttc
cctcagaaaacgatcttcgactctctggacgaaaatgaccttgacttcggcatttattac
cagaacatccccgccackctcttcttcaagagcytgaggaaactgaagcatgtgacgaaa
ttcmacagctacgcgctgactttcaagcggcacgctcagctggggaagctgccgaattac
gcggtratcgagcagaggtacttcgacgtcaaggagcttcccgccaacgacgaccacccg
tckcatgacgtggcgcgcgggcagaggttcgtgaaggaggtgtacgagacgctgagggcg
agcccrcagtggaaagaaatggcattgctgattacytacgacgagcacggcgggttttat
gaccacgtgccgacgccggtttyrgacgtgccgagcccggatgggatcgtggggaacgaa
ccgtattatttccggtttgaccggttgggtgtgcgggtgccgaccatactcgtctcgcca
tgggtcgaaawgggtaccggtgagttctctgcttctcggttttttcagttkgtttttttt
tttwawttttga

DBGET integrated database retrieval system