KEGG   Malus domestica (apple): 103427171Help
Entry
103427171         CDS       T03194                                 

Definition
(RefSeq) monofunctional riboflavin biosynthesis protein RIBA 3, chloroplastic
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00740  Riboflavin metabolism
mdm00790  Folate biosynthesis
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
Module
mdm_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    103427171
   00790 Folate biosynthesis
    103427171
Enzymes [BR:mdm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     103427171
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     103427171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydro2 DHBP_synthase
Motif
Other DBs
NCBI-GeneID: 103427171
NCBI-ProteinID: XP_008363464
Position
3
AA seq 547 aa AA seqDB search
MDSALAPHPLFPHILSSSSLHRSLAVRQCLFRQRWLNPTCWAIGVSGSSVGAAGNNLFGD
ANYLKGSENGSLLSGLDESASAGPFGTLDAEITPETVDFFVSDADGDPDCPSDGYSSIEQ
ALNTLRQGKFVIVVDDENGEVEGNLVMAASFANPKNVAFMIKQGSGIVSVGMMEEDLERL
ELPLMSPETEDEDSSAPTFTITVDAKVGTSTGVSAADRAKTVAALSSNESKPEDFRRPGH
VFPLKYRNGGVLRRAGHTEASVDLVVLAGLRPVSVLSAVVDADDGSMASLSNLRTLSLEH
SIPIVSITDLIRYRRKREKLVERKAVSRLPTKWGLFQAYCYRSKLDGTEHVAVVKGSIGN
GQDVLVRVHSECLTGDIFGSARCDCGNQLDVAMQLIEQAGRGVVVYLRGHEGRGIGLGHK
LQAYNLQDQGHDTVQANIELGLAVDSREYGIGAQILRDIGVRTMRLMTNNPAKFTGLKGY
GLAVVGRVPVLTPITEENKTYLETKRTKMGHVYGSDIQGLSDGLFINPNVNDQGLPESGN
TEDSNYT
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggactctgctctagctcctcaccccctcttccctcatatcctctctagctcgagcttg
catcgatctctcgcagttcgtcaatgtctgttccggcagaggtggttaaatccgacttgt
tgggctattggggtgtctggaagtagtgttggagcagctgggaataacctctttggtgat
gctaattatttgaaggggagtgaaaatggttctctgttgagtgggttagatgagtcagct
tcggcaggaccatttgggacgttggatgcggagatcacaccggagaccgttgatttcttt
gttagtgatgctgatggtgaccctgattgcccatctgacggctactcttccatagagcag
gcacttaacacattacgccaaggaaagtttgtgattgttgtagatgatgaaaatggggaa
gttgaaggaaacctagtcatggccgcgtcgtttgcgaacccgaaaaacgtagcgttcatg
atcaagcaggggtctgggattgtctcagtaggcatgatggaggaggatcttgaaagattg
gagcttcctctcatgtcaccggagactgaagatgaagactcttctgctcccacattcaca
atcacagtggatgcaaaagttggaacatcaaccggagtctcagctgcagacagggcaaaa
actgtggctgctctttcatccaatgagtctaaaccggaggacttcagaaggcctggccat
gtgtttcccctcaagtaccgaaatggcggggttcttaggagagcgggtcacactgaggct
tcggttgatctcgttgttctggccggcttaaggccggtgtctgttctttcagcagtagtt
gacgccgatgacggctctatggcctctttgtccaatttgaggacattgtctctggagcat
tccattccaattgtctccattactgatttgatcaggtacaggagaaagagggaaaaatta
gttgaaagaaaagccgtttcgcgtctacctacgaaatggggtctatttcaagcctattgc
tatcgctcgaagctagacggaacagaacatgttgcagttgtaaagggaagcattggaaat
ggacaagatgtgctagtaagagtgcattcggagtgtttgacaggagatattttcggatca
gcgcggtgcgactgtggaaaccagttggatgtggcaatgcagctaatcgaacaagccggt
cgaggagtcgttgtgtacctcagaggtcatgaaggaagaggcattggtctaggccacaaa
cttcaagcctataatctgcaggatcaaggccatgacaccgtccaggccaacatagaactc
ggactagctgttgattctcgtgaatatgggattggtgcccagatattgagagacataggg
gtccgaacgatgaggctaatgacgaacaacccggcaaagttcaccggtctaaagggatac
gggttggccgtggtcgggagggttccggttttgacaccaatcacagaggaaaacaagacc
tacttggaaacaaaaagaacaaagatgggacatgtttacggttctgatattcaaggactt
tcagatggattgttcatcaaccctaatgtaaatgaccaaggtctgccggaatcaggaaat
accgaagattcaaattatacgtag

DBGET integrated database retrieval system