KEGG   Malus domestica (apple): 103427663Help
Entry
103427663         CDS       T03194                                 

Definition
(RefSeq) glutamate--tRNA ligase, cytoplasmic-like
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00860  Porphyrin and chlorophyll metabolism
mdm00970  Aminoacyl-tRNA biosynthesis
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
Module
mdm_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    103427663
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103427663
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mdm01007]
    103427663
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mdm03016]
    103427663
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:mdm02048]
    103427663
Enzymes [BR:mdm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     103427663
Amino acid related enzymes [BR:mdm01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   103427663
Transfer RNA biogenesis [BR:mdm03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    103427663
 Prokaryotic Type
   Other AARSs
    103427663
Prokaryotic defense system [BR:mdm02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    103427663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1c_C GST_C GST_C_3 GST_C_2 tRNA-synt_1e GST_C_6
Motif
Other DBs
NCBI-GeneID: 103427663
NCBI-ProteinID: XP_008363953
Position
4
AA seq 728 aa AA seqDB search
MEVKVVSFPAENPPLAELVAAKLAGISLPTDASLPPDSPYSFQFSNGLKLHGXNVLLRYM
GRIAKLYGENAFEAGKIDEWLEYAPVLSQGSAFESACKHLDEYLGSNTFFANQSXSIADI
AIWSGLAGTGKRWESLRNSKKYPNLSRWFNSLLAGYGDALNEVTATFIGKKGSGKPIAAK
AKGNQVDPQSKGANGDASEKGKAGSKPTFEVDLPEAEVGKVRLRFAPEPSGYLHIGHSKA
ALLNQYFAQRYQGQLIVRFDDTNPDKESNEFVDNILKDIETLGIKYEKVTYTSDYFPQLM
KMAENLIRQGKAYVDDTPREEMKKERMDGIESKCRNNSLXENLKLWNEMIXGSKRGRECC
VRGKLDMQDPNKSVRDPVYYRCNPTPHHRIGSKYNLYPTYDFACPFVDSIEGITHALRSS
EYHDRNAQYYRVQEDMGLRKVHIYEFSRLNMVYTLLSKRKLLWFVQNEKVSGWDDPRFPT
VQGIVRRGLKVEALIQFILEQGASKNLNLMEWDKLWTINKKIIDPVCPRHTAVIEERRVL
LTLTNGPEKPFVRIIPRHKKYEGAGEKATTYTRRIWLDYADAEAIKVDEEVTLMDWGNAI
VKGIEKDEDGNLKLTGVLHPEGSVKTTKLKLTWLPESDELVKLSLMEFDHLITKKKLEED
EDFVDVVNPCTEKETAALGDSNXRNLKRGDILQLERKGYFRCDVPYLRPSKPIVLFAIPD
GRQQTGLK
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggaggttaaggttgtttcgttccccgccgagaaccctccgctcgcggagctcgtcgcg
gccaagctcgccgggatttctctcccaaccgacgcctctctccctcctgattccccttat
tcttttcagttctccaatgggttgaaattgcatggaaraaatgtactkctwcgatatatg
ggtcggattgcgaaattgtatggggagaatgcattcgaagctgggaagattgatgagtgg
cttgagtacgcgcctgtgctctcacagggttctgcatttgagagtgcttgtaagcatttg
gatgaatatttgggaagcaatacttttttygccaatcaatctttktcgatcgcggatatc
gcaatctggtccggtcttgcaggaactgggaaaagatgggagagtttgaggaattcaaag
aagtatccaaacctttctcggtggttcaattccctattagcyggatatggtgatgctctg
aatgaagtyactgctaccttcatcggcaagaaaggctcaggaaagccaattgcagctaaa
gcaaaaggcaatcaggttgatccgcagtcaaagggtgcaaatggagatgcatctgagaaa
ggtaaagcaggaagcaaaccaacatttgaagtagatcttcctgaagcagaggttgggaag
gttcgactgagatttgcgccrgaacccagtggttatcttcacattgggcactcaaaagca
gcgttattraatcaatattttgctcaacggtatcagggtcagcttattgtgcggtttgat
gatacaaatcctgataaagaaagcaatgagtttgtggacaatattctcaaggatattgag
actttgggtatcaagtaygaaaaggttacctatacttcagattactttcctcagttaatg
aaaatggctgagaatttgattcgccagggtaaagcatatgttgatgatacgccacgtgag
gagatgaagaaagaaaggatggatggcattgaatcaaaatgtagaaacaacagtctagak
gagaatcttaaattatggaatgagatgattgmtgggtctaagaggggtagggagtgctgt
gtccgtgggaagctggatatgcaggatccaaacaaatctgtccgtgatccagtttattat
cgctgcaatccaacaccacatcatcggattgggtccaagtacaacttatacccaacttat
gattttgcttgtccatttgttgattccatagaaggtatcacacatgcacttcgatctagt
gagtatcatgatcgcaatgctcagtactatcgagttcaagaggacatgggactgcgaaaa
gttcatatctatgaatttagtagattgaacatggtttatacrcttctcagcaagcgcaag
ctattgtggttcgttcaaaatgagaaggttagtggatgggacgatcctcgttttccaact
gtccaaggaattgtgcgcagaggtctcaaagttgaagccttaatacaattcattcttgag
cagggggcttcgaaaaatctgaatctcatggagtgggacaaactctggactattaataag
aagataattgatcctgtatgcccaagacatactgccgtcatcgaagagcgccgygtgttg
ttgaccctgaccaatggtcctgagaaaccatttgtccgcatcattcctaggcataagaag
tatgaaggtgctggggagaaggcaacaacatacacaaggaggatatggctagactatgct
gatgcggaggccatcaaagtagatgaggaagtwaccttgatggattgggggaatgccata
gttaagggaattgagaaggacgaagacggaaatctcaaactcacaggggtcttgcatccc
gagggttctgtcaagaccacaaaattgaagctcacctggctccctgaatcggatgagctt
gttaagctctcattgatggagtttgatcatctgataacaaagaagaagctcgaagaagat
gaggatttcgttgatgttgttaacccatgtaccgaaaaggagactgcagcacttggggat
tccaacatrcgaaatctcaagcgtggggacatattgcagctcgagaggaaaggatatttc
cgmtgcgatgttccctacctcaggccgtcaaagcccattgttctatttgcaatccccgac
ggcaggcagcagactggattgaagtaa

DBGET integrated database retrieval system