KEGG   Malus domestica (apple): 103427692Help
Entry
103427692         CDS       T03194                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PBL7
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
mdm  Malus domestica (apple)
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdm01001]
    103427692
Enzymes [BR:mdm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103427692
Protein kinases [BR:mdm01001]
 Serine/threonine kinases: TKL group
  IRAK family
   103427692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase APH Glycophorin_A Orf78 Kinase-like PIP49_C TMEM154
Motif
Other DBs
NCBI-GeneID: 103427692
NCBI-ProteinID: XP_028957296
Position
4
AA seq 443 aa AA seqDB search
MEVNTTAAASAGPLDLAAKNHTHKHQPYSHHQHHQGNFPSKSVLIIIISIISVMALLAII
FIVLMLRRLVKSTKTNGNIYKENTGLINTSCRSIAQTAVDFNSSPDVKGGCLQGGNSGRP
LKAPADKGVQVFSYKELEEATDKFSEANVIGHGGFGVVYKGVLRDGTVAAIKMLRREGRQ
GERAFRFEVDLLSRLHSPYLVELLGYCADQHHRLLIFECMPHGTLQRHLHPTNNHQPLDW
GTRLRIALDCAEALEFLHEHAIPSVIHRDFKCSNVLLDQNFRAKVSDFGLAKMGSDKING
QISTRVLGTTGYLAPEYASTGRLTTKSDVYSYGVVLLELLTGRVPVDTKRPPGEHVLVSW
ALPRLTNREKVLEMVDPALQGQFSKRDLIQIAAIAAMCVQPEAEYRPLMTDVVPSLIPLV
QNSSYGASSGSSRFHNQIPSPRC
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggaagttaacaccaccgctgctgcatccgcagggccacttgacctcgccgcaaaaaac
cacactcataaacaccaaccgtacagccaccaccaacaccaccagggaaactttccttca
aaatctgttcttatcatcatcatctccatcatctcagttatggcccttcttgctataatc
ttcatcgtactaatgcttagacggctcgtcaagtcgacgaaaacaaatggcaatatttac
aaagagaacaccggcttgatcaatacaagttgcaggtccattgctcaaaccgcagtggac
ttcaattctagcccagatgtgaagggtggttgtctccaaggagggaattctggaaggcca
ttaaaggcacctgcagacaaaggagttcaagtgttctcgtacaaagaacttgaggaagcc
actgataaattcagcgaggcaaatgtgatagggcatggtgggtttggagtggtgtataag
ggggtcctaagagatggaacagtggcagcaattaagatgctgcgcagggaaggcaggcaa
ggggagcgtgccttcaggtttgaggtggatctactaagccggttgcactctccatacttg
gtggagctacttggctattgtgctgaccagcaccataggctcctcatatttgaatgcatg
ccccatggtactctgcaacgccatctccatcctacaaacaatcatcagccgttggattgg
gggacccgactgaggatagcccttgattgtgctgaggcccttgagttcctccatgaacat
gcaatcccatctgttatacaccgtgacttcaagtgcagcaatgttctactagatcaaaat
tttcgtgccaaggtgtcggatttcggattggccaagatgggttctgacaagatcaacggt
cagatttcaacgcgtgtgctagggaccaccggttatctggcaccagagtatgcctcgact
ggaaggctcaccacaaaatcagatgtatacagctacggcgtggttcttttagagctctta
acagggcgtgtgccggtagacacaaaacggcctcctggagagcatgtccttgtttcatgg
gctcttccaaggttaactaacagagagaaagtattggaaatggttgatccagctcttcag
gggcaattctcaaagcgggatctaattcagatagcagctattgcagcaatgtgtgtgcag
ccggaagctgaatatcggcctctaatgacggacgtggtaccgtctctaattcctctggtt
caaaactcctcttatggtgcttcctctggttcgtctagatttcataaccaaataccaagt
ccaaggtgttag

DBGET integrated database retrieval system