KEGG   Malus domestica (apple): 103428963Help
Entry
103428963         CDS       T03194                                 

Definition
(RefSeq) heat shock 70 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mdm  Malus domestica (apple)
Pathway
mdm03040  Spliceosome
mdm04141  Protein processing in endoplasmic reticulum
mdm04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103428963
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103428963
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103428963
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mdm01009]
    103428963
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mdm03041]
    103428963
   03009 Ribosome biogenesis [BR:mdm03009]
    103428963
   03110 Chaperones and folding catalysts [BR:mdm03110]
    103428963
   04131 Membrane trafficking [BR:mdm04131]
    103428963
   03051 Proteasome [BR:mdm03051]
    103428963
   03029 Mitochondrial biogenesis [BR:mdm03029]
    103428963
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdm04147]
    103428963
Protein phosphatases and associated proteins [BR:mdm01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103428963
Spliceosome [BR:mdm03041]
 Complex B
  Other components
   Prp19 complex
    103428963
 Complex C
   Prp19-CDC5 complex
    103428963
Ribosome biogenesis [BR:mdm03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103428963
Chaperones and folding catalysts [BR:mdm03110]
 Heat shock proteins
  HSP70 / DNAK
   103428963
Membrane trafficking [BR:mdm04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103428963
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103428963
Proteasome [BR:mdm03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103428963
Mitochondrial biogenesis [BR:mdm03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103428963
Exosome [BR:mdm04147]
 Exosomal proteins
  Proteins found in most exosomes
   103428963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF4795 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 103428963
NCBI-ProteinID: XP_008365320
Position
17
AA seq 656 aa AA seqDB search
MASKTQGKAIGIDLGTTYSCVGVWQNDRVEIIVNDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPQNTVFDAKRLIGRRFSDPSVQSDMKHWPFKVVSGPGDKPMIVVNYKGEEKQFAA
EEISSMVLTKMREIAEAYLGHPCNNAVVTVPAYFNDSQRQATKDAGSIAGLNVMRIINEP
TAAAIAYGLDKKGSSTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRLVNHFVQEFKRKHKKDISSNARALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
STITRARFEEMNMDLFRKCMEPVEKCLRDSKIDKSRVDEVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILTGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARSKDNNLLGKFELTGIPPAPRGVPQI
NVCFDIDANGILNVSAEDKTAGVKNKITITNDKGRLNKEEIERMVQEAERYKAEDEEVKK
KVDAKNSLENYAYNMRNTIKDEQIAGKLDPADKQKIEKAIDEAIEWLDRNQLAEVEEFED
KQKELEGLCNPIIAKMYQRPGGNVPMGGGAQMPGSGFGNTTSGGGSGAGPTIEEVD
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaagacgcaaggcaaggccatcggcatcgacctcggcaccacctacagctgc
gtcggggtgtggcagaacgaccgcgttgagatcatagtcaatgaccagggcaacagaacc
accccttcctatgtcgccttcaccgacaccgagcgtttgatcggcgacgcagccaagaac
caggtcgccatgaacccccaaaacaccgttttcgacgccaagagactcatcggcaggcgg
ttctccgacccttctgtccagagcgacatgaagcactggcctttcaaggtcgtttctggt
cccggcgacaagcccatgattgtggtaaattacaaaggcgaagagaagcagtttgcggcg
gaagagatatcgtcgatggtgctgactaagatgagggagattgccgaggcttatttgggt
cacccttgcaacaacgctgtggtcactgtacctgcttacttcaatgactcacagaggcag
gccacaaaggatgctggctccattgccgggctcaatgtgatgaggattatcaacgagcct
actgctgctgctattgcttacggtcttgacaagaagggatccagtactggcgagaagaat
gttcttattttcgatcttggtggtgggacttttgatgtttctttgctcacaattgaggaa
ggcatcttcgaagtgaaggctactgctggcgatactcatcttggtggtgaggattttgac
aacaggcttgttaatcactttgtgcaagagtttaagagaaagcacaagaaggatattagt
agcaatgccagagctttgaggaggttgaggactgcatgcgagagggcgaaaaggactctg
tcttccaccgctcagactaccattgagatcgattcgctctacgaaggtattgatttctat
tctacaattactagggcgagatttgaagagatgaatatggatttgtttaggaagtgtatg
gaacctgttgagaagtgtttgagggattccaaaatcgacaagagtcgggttgatgaggtt
gttttggttggtgggtcgacgagaattcccaaagttcagcagcttttgcaagatttcttc
aatggcaaggaattgtgcaagagcataaaccctgacgaagccgtggcttatggtgctgct
gttcaagctgcaattttaaccggcgaaggaaatgagaaggtccaagatctgttgcttctt
gatgtcactcctctcagcctcggtcttgagactgcaggtggtgtcatgaccgtcttgatt
ccgagaaataccaccattcctaccaagaaggagcagatcttctctacctactccgacaat
cagccaggagtgttaattcaggtgtatgaaggagaaagggctagatccaaggacaacaac
ctcctcggcaagtttgaactcacgggcattcctccggcgccaagaggcgtccctcagatc
aatgtctgctttgacattgatgcaaatggtatcttgaatgtgtcggcggaggacaagact
gctggagtgaagaacaagatcactattaccaacgacaagggaagactgaacaaggaagag
attgagcgaatggtgcaggaggcagagaggtacaaggctgaagatgaggaggtgaagaag
aaggtggatgccaagaactcgcttgagaactacgcatacaacatgcggaacaccatcaaa
gatgagcagattgctggaaaattagaccctgcagacaagcagaagattgagaaggccatt
gacgaggcaatcgagtggctagaccggaaccagttggccgaggtggaggaatttgaggac
aagcaaaaggagttggagggattgtgcaacccgatcattgccaaaatgtatcagcgtcct
ggcggaaacgtgccaatgggcggtggtgctcagatgcccggtagcggatttggaaacact
acgtccggtggcggatcaggagccgggcctacgattgaggaagttgactga

DBGET integrated database retrieval system