KEGG   Malus domestica (apple): 103429668Help
Entry
103429668         CDS       T03194                                 

Definition
(RefSeq) thiamine thiazole synthase, chloroplastic
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00730  Thiamine metabolism
mdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    103429668
Enzymes [BR:mdm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     103429668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO FAD_binding_2 NAD_binding_8 Pyr_redox_2 GMC_oxred_N Lycopene_cycl HI0933_like FAD_oxidored NAD_binding_9 GIDA Pyr_redox_3 FAD_binding_3 RNA_pol_Rpb1_3 B12D Pyr_redox
Motif
Other DBs
NCBI-GeneID: 103429668
NCBI-ProteinID: XP_008366026
Position
3
AA seq 359 aa AA seqDB search
MATMASTLTSSSLTAKLQKSSLLDSSFHGAPMVRLQLAKAAPANNGGLSVSMSANGLTPS
YDLSAFKFDPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPDVQV
AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIDYDEQDNYVVIKHAALFTSTIM
SKLLARPNVKLFNAVAAEDLIIKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSS
CGHDGPMGATGVKRLRSVGMIESVPGMKALDMNAAEDAIVKLTREIVPGMIVTGMEVAEI
DGSPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIQPELILAAAESAEIAEA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccatggcttccaccctcacctcctcctccctcaccgccaagctccagaagtcc
tccctcctcgactcctccttccatggcgctcccatggtccgccttcagctggccaaggcg
gcccccgccaacaacggcggcctctccgtctccatgtccgccaacggcttgaccccctcc
tacgacttgagcgctttcaagttcgaccccatcaaggaatccatcgtctcccgggagatg
acaaggcgctacatgactgacatgatcacctacgccgacaccgacgtcgttgtcgtcggt
gctggctccgccgggctatcctgcgcctacgaactcagcaagaaccccgacgttcaggtc
gccatcatcgagcagtccgtcagccccggtggaggtgcatggctcggtggccagctcttc
tctgccatggttgtgcgcaaacccgcccatctcttccttaacgagctcggcattgactac
gatgagcaagacaactacgttgtcatcaagcacgccgccctattcacctccaccatcatg
agcaagctccttgcccggcccaacgtgaagctcttcaacgctgtggccgccgaggacttg
atcattaagggtggcagagttggtggggtggtcaccaactgggccttggtctcaatgaac
cacgacacacagtcgtgcatggaccccaacgtcatggaggccaaggttgtggtgagctca
tgtggtcatgacggacccatgggagccaccggcgtaaagaggctgaggagcgttgggatg
attgagagcgtgcccgggatgaaggccttggacatgaacgcagctgaggatgctatcgtg
aagctcacaagggaaattgtgccaggaatgatcgtcaccggcatggaagttgccgagatt
gatggatccccaagaatgggacctacattcggagccatgatgatctcagggcaaaaggca
gctcacttggcattgaaggcactgggactccccaacgcattggatggatcatacgtcgga
ggcatccagccggagctgatcctagctgctgcagaatccgctgagatcgccgaggcttaa

DBGET integrated database retrieval system