KEGG   Malus domestica (apple): 103433868Help
Entry
103433868         CDS       T03194                                 

Definition
(RefSeq) nicotianamine synthase-like
  KO
K05953  nicotianamine synthase [EC:2.5.1.43]
Organism
mdm  Malus domestica (apple)
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103433868
Enzymes [BR:mdm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.43  nicotianamine synthase
     103433868
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAS Methyltransf_31 CheR
Motif
Other DBs
NCBI-GeneID: 103433868
NCBI-ProteinID: XP_008370376
Position
4
AA seq 325 aa AA seqDB search
MCCQGDALVQRVCELYEKISSLESLKPSQDVNMLFTQLVLTCIPPSPIDVSKLCRGVQEI
RSNLIRLCGEAEGLLENHFSTILGSFEHPLDHLDIFPYYSNYLKLSKLEFNILSQHFTRV
PSKIAFVGSGPLPLTSIVLASNHLTKTSFDNYDIDTLANSMALRLVSSDPDLSKRMVFHT
TDIMDVTTALKDYEVVFLAALVGMDKMEKLKIIDHLAKYMAPGATLMLRSAHGARAFLYP
VIDPCDDLRGFEVLSVFHPTDEVINSIVIARKYALPVQHSSSIDSQEINNAGAIRLPSKC
CEIEAFNPFHKLGNMIEELAFEEQL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtgttgccagggagatgctttggtacaaagagtgtgtgaattgtatgagaaaatctca
agcctagagagcctcaaaccctcccaagatgtcaacatgctcttcacccaactcgtcctg
acatgcataccaccaagtccaatcgatgtttccaagttatgccgaggggtgcaagaaata
aggtcaaatcttataaggctttgtggagaagcagaaggacttttggagaatcacttctca
acaatcctaggctcatttgagcaccctctcgaccatctcgacattttcccttactattcc
aattacctcaagcttagcaaacttgagttcaacatccttagccaacacttcacccgtgtg
cctagcaaaattgcctttgtgggttctggccctcttccccttacttcaattgtcttggcc
tccaatcacctcaccaaaacctcttttgacaactatgacatcgacacattggccaactca
atggctcttcgcttagtgtcatccgatcctgacctatcaaaaaggatggtcttccacacc
acagatataatggatgtcacaactgcyttgaaagactatgaagttgtgtttttggctgct
cttgttggcatggacaagatggagaagctgaaaattatcgatcacttggcgaaatacatg
gctccaggagcaactttgatgctaaggagtgcacacggcgcgagagcttttctttatccg
gtgattgatccttgtgatgatcttagagggtttgaggttctctctgtgtttcatcccacc
gatgaagtcattaattcgattgtcatcgcgcgtaaatacgcattgcctgttcagcactca
tcatcaattgattctcaggagattaataatgctggtgccattagacttcccagcaagtgt
tgtgagattgaagccttcaatcctttccataaacttggaaacatgattgaggagttggcc
ttcgaggagcagctttaa

DBGET integrated database retrieval system