KEGG   Malus domestica (apple): 103434728Help
Entry
103434728         CDS       T03194                                 

Definition
(RefSeq) amidase 1-like
  KO
K01426  amidase [EC:3.5.1.4]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00330  Arginine and proline metabolism
mdm00360  Phenylalanine metabolism
mdm00380  Tryptophan metabolism
mdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    103434728
   00360 Phenylalanine metabolism
    103434728
   00380 Tryptophan metabolism
    103434728
Enzymes [BR:mdm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     103434728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 103434728
NCBI-ProteinID: XP_008371303
Position
5
AA seq 186 aa AA seqDB search
MAIDSDHGAFVEKFLLRPPSSSHDLPLSGLTFAVKDIFDVAGRVTGFGNPDWARTHPAAE
STAPAVSAILSGGATSIGITVMDEMAYCMNGENKHYGTPRNPCAPDRVPGGSSSGSAVAV
AVGLADFSLGTDTGGSVRIPASHCGIFGFRPSHGVISTSGVTPLAQSFDTVGEKSMTFYI
ADWLRK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggcgatagactcagatcatggagctttcgtggagaaattccttctccgaccgccgtct
tcatcacatgaccttcctctgagtggcctcacctttgctgttaaagacatatttgatgtg
gctggacgtgtgactgggtttgggaatcctgattgggcgaggactcacccggctgctgaa
tcaacagctccggctgtttcmgcaatattgagtggaggtgccacaagtattggtataact
gtcatggatgaaatggcatactgtatgaatggagagaacaagcattatggcacacccaga
aatccgtgcgctccagatagggtgcctggaggctcttctagcggttctgctgttgccgta
gctgtaggcctcgcagatttttccttaggaactgacactggaggaagtgtaagaattcct
gcgtcgcattgtggaatttttgggtttcggccatctcatggtgtcatttctacttctgga
gttactcctctggcacaaagtttcgatacagtgggtgagaaatcaatgacattttatatt
gcagactggcttaggaaatag

DBGET integrated database retrieval system