KEGG   Malus domestica (apple): 103434765Help
Entry
103434765         CDS       T03194                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: lactosylceramide 4-alpha-galactosyltransferase
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00601  Glycosphingolipid biosynthesis - lacto and neolacto series
mdm00603  Glycosphingolipid biosynthesis - globo and isoglobo series
mdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    103434765
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    103434765
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mdm01003]
    103434765
Enzymes [BR:mdm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     103434765
Glycosyltransferases [BR:mdm01003]
 Glycan extension
  P blood group
   103434765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 103434765
NCBI-ProteinID: XP_008371339
Position
5
AA seq 473 aa AA seqDB search
MFDCESSKLPNPLHVLIHHIQELKRQILSLLLCLPTSLLALLLLLLLAYNGFYIFCFHLP
FLPDSPPERAIFPPEKVAGDSVPKWVPPHFTSSSSTSSSKLSSSLPVMYVVKEENAPMFL
NPHLSALQNQRNPTVPISTLSTHRRRRLRKHKRKLKSVPTEPKPPLFSTRIRSFFAGNST
SPCNVRVFMTWISSKSFGSRELLSVESLFKSHPNTCLAIVSKSLDSDKGIRMLRPFQDLG
FRAIAISPDFEYLLKDTPAESWYFELRKGTVNPGGVSIGQNLSNLLRLALLYKFGGIYLD
TDFVVLKSLSKLRNVIGAQTIDPITKKWSRLNNAVLVFDKNHTLLFKFIQEFALTFDGNK
WGHNGPYLXSRVVSRVIGNQQNPGSNFTVLTPSAFYPVNWSRIRSLFRAPTDEVHSKWRL
EKLRNLCTQSFGVHLWNSQSRRLKVEKGSIMDHIMSEFSVFSNSSASSFVSVV
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtttgattgtgaaagctccaaacttcccaatccactccatgtcctcatccaccatatc
caagaattaaagaggcagattctctctcttcttctctgcctccccacttcccttctcgct
ctcctcctcctcctcctcttagcctacaacggcttctacatcttctgcttccacctccct
ttcctccccgattccccgccggagcgcgccattttccctcctgaaaaagtcgccggagac
tccgttcccaaatgggttcctcctcattttacgtcttcttcttccacctcaagctcaaag
ctttcttcttctttgcctgtaatgtacgttgtgaaagaagaaaacgcgccaatgttcttg
aacccccatttgtctgctctgcaaaaccagaggaatccgacggtacccatctcgacatta
tcgacacacaggcggcggcgtctgaggaagcacaagcggaagctcaaatccgttcctacc
gagccaaaaccccctctgttttcgacacgaattcgatcattcttcgccggaaactccacc
tctccctgtaatgtcagagtctttatgacttggatttcctccaagtccttcggaagcagg
gaattgctttccgtggagagcttgttcaagtcccatccgaatacctgcctggccatcgtg
tcgaaatcattggattccgataagggaatccgaatgctgaggccatttcaagatttgggt
tttagagcaattgcaatctctcccgatttcgagtacttgttgaaggacacacctgcagaa
tcttggtatttcgaactccggaaagggactgtgaatccgggtggagtttctataggccag
aatctctccaatctcctcaggcttgcattgctgtacaagtttggtgggatttacttagac
acggatttcgtagttttaaagagcttgtcgaagctcaggaacgtgattggagctcagaca
attgatcccataacgaagaaatggagtagactaaacaacgcagtgttggttttcgacaag
aaccacacattgctcttcaagttcatccaagaattcgccctcacattcgatggcaacaag
tggggacacaacggcccttacttgnngtcgagggtggtctcaagagtgatcggaaatcag
caaaacccgggttctaatttcacagtcttgacgccctcggcgttctatccggtgaactgg
agtcgaattcggagcctttttcgagctccaacagacgaagttcactcgaagtggcggctg
gagaagttgaggaatttgtgtactcagagctttggagttcacttgtggaacagccagagc
cggcggttgaaggttgagaagggcagcattatggatcatataatgtcggaattttcggtg
ttttcaaactcttcagcatcaagctttgtcagtgtagtataa

DBGET integrated database retrieval system