KEGG   Malus domestica (apple): 103437475Help
Entry
103437475         CDS       T03194                                 

Definition
(RefSeq) magnesium protoporphyrin IX methyltransferase, chloroplastic-like
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00860  Porphyrin and chlorophyll metabolism
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    103437475
Enzymes [BR:mdm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     103437475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_11 Methyltransf_31 MTS Ubie_methyltran PrmA Methyltransf_18 Methyltransf_32 CMAS NodS TPMT Methyltransf_9 TehB tRNA_U5-meth_tr
Motif
Other DBs
NCBI-GeneID: 103437475
NCBI-ProteinID: XP_008374163
Position
6
AA seq 323 aa AA seqDB search
MASSASLSLPLHFPNPNPRPIFFPKPTKSTTLKPPARTTTVKPLFALPPADVDSATIAAI
GGGSVAALAAALSLSDPENRRRLQAEEVGGGDKEVVKDYFNKSGFERWKKIYGETDDVNR
VQRDIRLGHSKTVENVMKMLTDEGPLQGVSVCDAGCGTGCLAIPLAKEGAVVTAADISAA
MVAEAEKQAKEQLKLSNGFSAGPVLPKFVVKDLESLDGKYDTVVCLDVLIHYPQSKADGM
IAHLASLAENRLLISFAPKTLYYDVLKRIGELFPGPSKATRAYLHSEADVERALKKVGWR
IRKRGLTTTQFYFSRLVEAVPAN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctccgcctcgctatctttgccactycacttccccaaccccaatcccaggccc
atattcttcccaaagcccacaaaatccaccaccctaaaaccccctgcccgcaccaccacc
gtcaagcccctcttcgccctcccacccgccgacgtcgacagcgctactatcgccgccatt
ggcggcggctcggtggccgcccttgccgccgcgctctccttatccgacccggaaaacagg
cgccgcctccaggccgaggaggtcggcggcggcgacaaggaggtcgtgaaggactacttc
aacaagtccgggttcgagcggtggaagaagatatacggagagacggatgacgtcaacagg
gttcagagggacatcaggctcggccactccaagaccgttgagaatgtgatgaagatgttg
accgatgagggcccacttcagggggtctctgtgtgcgacgccgggtgtgggaccgggtgc
ttggccattccgctggcgaaggaaggggccgttgtcacggctgctgatatttcggctgcc
atggttgcagaggctgagaagcaggcaaaagagcagcttaagttaagcaatggcttctca
gcagggccagtactgccgaaattcgtagtgaaggatttggagagcttggatgggaagtac
gacacagtggtctgtcttgatgttttgattcattacccgcagagcaaggctgatgggatg
attgcccatcttgcttcattggcggagaatcgcttgcttataagttttgcgccaaagaca
ttgtattatgatgtgctaaagaggataggagagttgttcccggggccttcgaaggcaacg
agggcgtatctacattcggaggcagatgtggagagagccttgaagaaggttgggtggagg
ataaggaagagaggactaaccactacacaattttatttttcgaggctggtcgaggctgtt
cctgctaattga

DBGET integrated database retrieval system