KEGG   Malus domestica (apple): 103439710Help
Entry
103439710         CDS       T03194                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: calcium-dependent protein kinase 26-like
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
mdm  Malus domestica (apple)
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdm01001]
    103439710
Enzymes [BR:mdm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103439710
Protein kinases [BR:mdm01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   103439710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo YrbL-PhoP_reg Kinase-like APH RIO1 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 103439710
NCBI-ProteinID: XP_008376518
UniProt: A0A498JNS9
Position
7
AA seq 503 aa AA seqDB search
MAVARSNSSSAASTWPCNCYKVASLTSSILDANETSNLKDRYILGEQLGWGQFGVIRVCT
DKLTGEVLACKSIAKDRLVTSDDVRGIKLEIEIMTRLSGHPNVVDLKAVYEEEEYVHLVM
ELCAGGELFHQLEKHGRFSKSDARVLFRHLIQVVLYCHENGVVHRDLKPENILLATKASS
SPIKLADFGLATYIKPGQSLHGLVGSPFYIAPEVLAGSYNQAADVWSAGVILYILLSGMP
PFWGKTKSRIFDAVRTADLKFPSDPWDRITGSAKDLIRAMLCKDPSQRLTAQQVLDHPWM
RVNEPYPKQPSQCENGGRGECDVAGSSFCTMSRSQDISFGTASHNACDAQSPTFTCRSSF
SALMVEPFTPHLASGGFSFCSDGDSNXLEFSSPIPSMPSFAFFSPGSLVEEGSCAIEFSA
SISRVDAIHGGSLSFRLETRQMVNKPAEAKRTGGTRTSAIHNKRNRTIGLGEHEQLDFMV
TESIIRWSSCTNLPTSLRSSLVC
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgccaggagcaacagcagcagtgcagcatcaacgtggccgtgcaattgttac
aaagtcgcaagcttgacttcctccattttagatgcaaacgagacttcaaatctaaaagat
cggtacattctaggagagcagttaggttgggggcagtttggtgttatcagggtgtgcact
gataagttgaccggagaggtcttggcatgtaaatcaattgctaaagatcgattagtgacc
tcagacgatgtgcgaggcattaaacttgagattgaaattatgaccaggttatctgggcac
ccaaatgttgtagatctcaaggcggtgtatgaagaggaagagtatgtccatttggtgatg
gagctttgcgcaggaggagagcttttccaccagttagagaagcacggtcgattctccaag
tctgatgccagggttctctttaggcatctgattcaggtagttctatattgtcacgaaaat
ggggttgttcacagagatttgaaaccagagaacatcctattggccacaaaagcctcctcg
tctccaatcaagttggcagattttggtcttgcaacctacatcaagcctgggcagagtttg
catgggttagttggtagtccgttttatatagctcctgaggtacttgcaggtagctataac
caggctgcagatgtgtggagtgcgggcgttattctctacattcttcttagtggaatgccg
ccattttgggggaagacaaaatcacggatatttgatgctgttaggacagctgacctgaaa
ttcccatctgatccctgggatcgcattactggatcagctaaggatttgattagagcaatg
ctctgtaaagatccttcacaaaggctcactgctcagcaggttttagatcatccttggatg
agggttaatgaaccatatcctaaacagccgagtcaatgtgaaaatggaggccgtggagaa
tgtgatgtagccggcagctcattctgtactatgtccaggagtcaagacatcagctttggc
actgcatcacataatgcatgtgatgcccaatcacctacatttacttgtaggtcatctttt
tctgctctcatggtggaaccatttactccccacttagcatccggcgggttttcattctgc
agcgatggtgattctaatnagttggaattctcctcccccattccctcaatgccaagcttt
gcattcttcagccctggttctttggttgaggaaggtagttgtgcgatagagttttcagcc
agcatatccagagtagacgcaattcatggaggttccctttcgttcagacttgaaacgaga
caaatggttaacaaaccagccgaagctaaaaggacaggtggaacaaggacgtcagccatt
cacaacaagagaaaccgtacaattggacttggtgagcacgagcaactagatttcatggtg
accgagtcaatcattcgttggtcatcatgcacaaatcttcctacatctctgagatcttct
cttgtctgttga

DBGET integrated database retrieval system