KEGG   Malus domestica (apple): 103440458Help
Entry
103440458         CDS       T03194                                 

Definition
(RefSeq) wall-associated receptor kinase-like 14
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
mdm  Malus domestica (apple)
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdm01001]
    103440458
Enzymes [BR:mdm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103440458
Protein kinases [BR:mdm01001]
 Serine/threonine kinases: TKL group
  IRAK family
   103440458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr EGF_3 GUB_WAK_bind EGF
Motif
Other DBs
NCBI-GeneID: 103440458
NCBI-ProteinID: XP_008377371
Position
8
AA seq 694 aa AA seqDB search
MSYFTLILSVLVFPLLTIHAANHCNQSCPSFGPIPIQYPFGFSSGCEIQLNCTPNSGFAI
GEFPIQSITQDSIRINLQSRCNRPLHTLLHLYSRNYAPTSRNAILLQNCTDGRPSSSCEI
PNILVQARFDAPPNCSANSSLSCYAEARKDVQFLNFGSVEQKDCKFLLSSISASSPQLLN
SSTPLLLEVEVVELEWWLEGTCGCDKNANCTTVVSPNGTEGYRCNCKEGFDGDGYVAGLG
CRKVSSTCNPAKYLSGECGGKTRFIVLIGAVFVGASLMISLALICCFIRRRSKLKARHST
KRLLSEATGNCNIPFYSYKEIEKATTSFSDKQRLGTGAYGTVYAGKLHDEWVAIKRIKHR
GHESIDQVMNEIKLISSVRHPNLVRLLGCSIERGEQILVYEFMGNGTLCQHLQRERGEGL
SWLTRLTIAAETAKAISHLHSAVKPPIYHRDIKSSNILLDCKLKSKVADFGLSRLGMAET
SHISTAPQGTPGYLDPQYHQNFHLSDKSDVYSFGVVLVEIITGLKAVDFTRPQNEVNLAA
LATDRIGRGCLNEIIDPFLEPLLDDAWTLSSVHKVAELAFRCLAFQRDMRPTMIEVTAEL
ELIKLSKWPSSEENTYTASSDGSSCCSSSSVSEKPLNITKSRSLRSVNALQSGDAGSFNS
SEKFKHNSPVSVQNTWLSDQSSPSSNSLLSNVIQ
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgagttatttcaccctaattttatccgtacttgtttttccactactcaccatccatgca
gcaaatcactgcaaccaatcgtgcccgagtttcggtcccatcccgattcagtaccccttc
ggattctcatcgggctgcgaaatccagcttaactgcactccaaacagcggattcgcaatc
ggggagtttccaatccagtccattacccaggacagcataagaatcaacctccagagccgt
tgcaaccgccccctccacaccctcctccacctgtacagccggaactacgccccgacgtca
cgaaacgcaattcttttacagaactgtacggacggtaggccgtccagcagctgcgagatt
cccaacattctggtgcaggcgcggttcgacgcgccacccaactgcagcgccaacagcagc
ctcagctgctacgccgaggccagaaaggatgtccaatttctgaactttgggagcgtcgag
cagaaggactgcaagttcttgctgtcgtcgatttcggcgtcgtcgccgcaacttttgaat
agctcgacgccgctgttgctggaggtggaagtggtggagttagagtggtggcttgaggga
acttgcgggtgtgataagaacgccaattgtacgacggtcgtatcgccaaatgggacagaa
gggtatagatgcaactgcaaggaggggtttgatggagatggatacgttgctgggttaggc
tgcaggaaagtctcatcgacttgcaaccctgcaaaatacttgtctggagaatgtggagga
aagaccaggttcatcgttttgattggagctgtgtttgttggagcttctttaatgatcagt
ctggctctgatatgctgcttcatccggcggcgatccaagctgaaagcgagacactccacg
aaacgccttctgtccgaagctactggcaactgcaacattcccttctactcctacaaagaa
atcgaaaaagccacgactagcttctcagacaagcaaaggctaggaaccggagcttatgga
acagtttacgcaggaaaactccacgacgaatgggttgccataaagagaattaaacacaga
ggacatgaaagcattgaccaagtcatgaacgagatcaagctcatttcatcggtaaggcac
ccgaatttagtccggttattaggttgctccattgaacgtggtgagcagattcttgtgtac
gagttcatggggaatgggacattgtgtcagcatttgcaaagagagagaggggaaggactt
tcttggctcacacgcctgaccattgctgctgaaactgcgaaagcaatatcccatctccac
tcggctgttaagcctccgatataccacagagacatcaagtcgagcaacattcttttggac
tgcaagctcaaatccaaagtcgctgactttggcctttcgaggcttgggatggcagaaacc
tcccacatttcaacggctccacaggggactccgggttatcttgatcctcagtaccatcag
aacttccatctctccgataaaagcgatgtctacagctttggtgtggtgcttgtcgagata
ataacagggttaaaagcggtagattttacccgcccccagaatgaagtgaacttggcggct
ctagccactgacagaataggaagggggtgtctaaatgagatcatagacccttttctggag
ccccttttggatgacgcttggaccctttcgtcggttcataaggtcgccgaattggcattc
agatgccttgcatttcaacgagacatgagaccaactatgatagaagtgacagccgagttg
gagctcatcaagctaagtaaatggccatcttcagaagaaaacacatacacagcttcatca
gacggatcctcttgctgttcttcctctagcgtgagcgaaaagcctctaaatattaccaaa
tcccgatcactgagaagcgtcaatgcactgcagagtggagatgccggtagcttcaattcg
agcgaaaagttcaagcataattcaccggtctctgttcaaaatacttggttaagcgatcag
agctcgccttcatcaaacagtttgctgagtaacgtaattcagtga

DBGET integrated database retrieval system