KEGG   Malus domestica (apple): 103443506Help
Entry
103443506         CDS       T03194                                 

Definition
(RefSeq) 3-ketoacyl-CoA thiolase 2, peroxisomal
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00071  Fatty acid degradation
mdm00280  Valine, leucine and isoleucine degradation
mdm00592  alpha-Linolenic acid metabolism
mdm01040  Biosynthesis of unsaturated fatty acids
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
mdm01212  Fatty acid metabolism
mdm04146  Peroxisome
Module
mdm_M00087  beta-Oxidation
mdm_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103443506
   00592 alpha-Linolenic acid metabolism
    103443506
   01040 Biosynthesis of unsaturated fatty acids
    103443506
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103443506
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103443506
Enzymes [BR:mdm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     103443506
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 103443506
NCBI-ProteinID: XP_008380600
UniProt: A0A498JX47
Position
4
AA seq 459 aa AA seqDB search
MEKAINRQRVLLDHLRPPSADSSSSLSASACAAGDSAAYARTHVFGDDVVIVAAYRTPIC
KAKRGGFKDTHADDLLAPVLKAVVERTNVNPSEIGDIVVGTVLAPGSQRASECRMAAFYA
GFPETVPIRTVNRQCSSGLQAVADVAASIRAGFYDIGIGAGLESMTANPMAWEGSVNPKV
KMFEQAQNCLLPMGITSENVAHRFGVSRKEQDQAAVDSHRKAAAATATGKFKDEIIPVAT
KIVDPKSGEEKPVTISVDDGIRNTTLADLAKLKPVFKKDGSTTAGNSSQVSDGAGAVLLM
KRSVAEQKGLPILGVFRSFSAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINEAF
ASQYLYCRNKLGLDPEKINVNGGALAIGHPLGATGARAVATLLHEMKRRGKDCRFGVISM
CIGTGMGAAAVFERGDSVDGLCNARKVESHIHLLSKDAR
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagcgatcaacaggcagcgtgttctgctcgaccacctccgccctccctccgcc
gactcttcttcttctctctccgcatcggcatgtgcggctggggacagcgctgcatatgcg
aggacacacgtgttcggagatgatgtggtgattgttgcagcttatcggactccgatttgc
aaggcgaaacgcggcggcttcaaggatactcatgctgatgatcttcttgcacctgttttg
aaggcagttgtagaaaggaccaatgtgaacccaagtgaaattggagatattgttgtgggt
acagtgttggctccaggatctcaaagagctagtgagtgcagaatggctgccttttatgct
ggcttccctgagactgtgccaattagaaccgtgaacagacaatgttcatctgggctccag
gccgttgctgatgtagctgcgtctataagggcaggattttatgatattggaattggagct
gggttggaatctatgactgcaaatccaatggcatgggaaggatcagttaaccctaaagtg
aagatgtttgaacaagcccagaattgccttcttcctatgggaatcacctcagaaaatgtt
gctcatcgatttggagtttcacggaaggagcaagatcaggctgcagttgattctcatagg
aaggcagctgctgctactgctactggtaaatttaaagacgaaattattcctgtggcaacc
aagattgtcgacccaaaatctggtgaggagaaacctgttacaatttctgttgatgatggg
attcggaacacaacattggcagacctggcgaagttgaagcctgtatttaagaaagatggg
agcaccactgctggcaactctagtcaagttagtgatggtgctggagctgttctcttgatg
aagagaagcgtagctgagcaaaaaggattgccgattctgggtgtattcaggagtttttct
gctgttggtgtggatccagccatcatgggtgttggcccagctgttgcaattccagctgca
gtcaaggctgctggtttagagcttgatgatattgatctttttgagataaatgaggccttt
gcatcccaatatctctattgccgtaacaagttgggccttgatccagaaaagatcaatgtt
aatggaggtgcacttgccattgggcatccacttggtgcaacaggtgctcgcgctgttgcc
actttattgcacgagatgaagcgacgaggaaaggactgccgctttggagtgatatcaatg
tgcataggcacagggatgggggcagcagctgttttcgaaaggggggactctgtcgacgga
ctgtgtaatgcgcgcaaagttgaatcccacattcatcttttgtccaaggatgctaggtag

DBGET integrated database retrieval system