KEGG   Malus domestica (apple): 103446472Help
Entry
103446472         CDS       T03194                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: sphingosine kinase 1-like
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00600  Sphingolipid metabolism
mdm01100  Metabolic pathways
Module
mdm_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    103446472
Enzymes [BR:mdm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     103446472
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 103446472
NCBI-ProteinID: XP_028966233
Position
10
AA seq 497 aa AA seqDB search
MDRPGRVPESAPPESLISDRVLINGVVTPVTLFSDGVLQWSQRGHRSLIVEKEVLGFAAE
GPKIRIRALVEGRAGICCAASRGAVARKDLVFEPLFEESHRLWCQKLRDYIDSLGRPKRL
FVFVNPFGGSKSASKIYLDHVKPLFEDAGIQFTLQETRYQLHAKEVAKTLDLSKYDGVVC
VSGDGILVEVVNGFLEREDWDAAIKIPLGVVPAGTGNGMXKSLSDSVGEPCTPSNAVLAI
IRGHKRSLDVATICQGKTKFFSVLMLAWGLVADIDIESEKYRWMGSARLDFYAVQRIVRL
RQYHGSISFVPAPGFETYGEPTSYSNDSEPANQHIACAPNQEEPINIRQHGYEGPDINLD
SMDWRTIRGPFVSIWLHNVPWGGEDTKAAPDAKFSDGYIDVILMRACPKLSLLSLMAGLS
TGSHIKSPYVLYFKVKAFILQPGPRTEDPVKGGIIDSDGEVLARGRGAYKCDQKTLMTYD
ELQITVDQGLATLFSPV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggaccgacccggacgcgtacccgagtccgctccaccagaatcccttatctccgaccgg
gttctcataaacggcgttgttacaccggtgactctattctccgacggagtgctccagtgg
tcgcagagaggtcaccggagcttgatcgtcgagaaggaggtcctcgggttcgcggcagaa
ggcccgaagattaggataagagctttagttgaaggccgagctggaatctgctgcgccgcg
agcagaggagctgtggcgcggaaggacttggtgttcgagcctctctttgaggaatcgcac
cggctctggtgccagaagctccgtgattacatcgattctctcggacggccaaagaggctg
tttgtttttgtgaatccgtttggtgggagcaaatctgcttcaaagatttatcttgatcac
gtaaaacctcttttcgaggatgccggcatccaatttacgctgcaagaaactcgatatcaa
ctacatgcgaaggaagttgctaaaacactagatctttcaaagtatgatggcgttgtttgt
gttagtggggatggaatcttggttgaggtagtaaatggattccttgagagagaggattgg
gatgctgcaataaagatcccccttggagtagttcctgcaggtactggaaatggaatgngc
aaatctctttcggattctgttggtgaaccttgtacaccttctaatgctgttctcgccatt
attcgagggcataagcgttcactggatgtagctaccatatgccaggggaagaccaaattc
tttagtgtattgatgcttgcatggggtttagtggcagatattgacattgagtctgagaag
tataggtggatgggaagtgctcgactagatttctatgctgttcaacggattgtgcgtttg
aggcaatatcatggatctatttcgtttgtgcctgcaccgggctttgaaacttacggagag
ccgactagttacagtaatgacagtgaacctgctaaccaacacattgcatgtgctccaaat
caagaggaaccgattaacattcgacagcatggctatgaggggcctgatattaacttggat
agcatggactggagaactattagggggcccttcgtttcaatctggcttcacaatgtgcct
tggggtggtgaagacacaaaggcagcgcctgatgccaagttctcggatggttatatagac
gtgatattgatgagggcctgtccaaaattatcattgctctcgttgatggctgggttgagc
accggaagccatatcaaatcaccatatgtcttgtacttcaaggtgaaagcatttattttg
caacctggtcctcgcaccgaggacccagttaagggagggataatcgactcagatggcgag
gtcctggctagaggcagaggagcatacaaatgtgaccaaaagacactgatgacgtacgac
gaacttcaaataaccgtggatcaaggtttagctactctgttttccccagtatag

DBGET integrated database retrieval system