KEGG   Malus domestica (apple): 103446477Help
Entry
103446477         CDS       T03194                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
mdm  Malus domestica (apple)
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103446477
Enzymes [BR:mdm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     103446477
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 NAD_binding_8 EF-hand_6 EF-hand_7 EF-hand_5 PhaC_N DUF1858 Phage_DsbA p25-alpha LysR_substrate
Motif
Other DBs
NCBI-GeneID: 103446477
NCBI-ProteinID: XP_008383824
Position
10
AA seq 585 aa AA seqDB search
MRGFAFFDRVSKAFHDYPKASKMLVVVAVSGGGYVAYAEATPEPKLISSAPVIDQVDNKK
QKIVVLGTGWAGTSFLRNLKNPNYEVQIISPRNYFAFTPLLPSVTCGTVEARSIVEPIRN
IVRKKNVDVQFTEAACLKIDAQNNKIYCHSNLENNLDGQEEFVVDYDYLIIAVGANVNTF
NTPGVMENCHFLKEVEDAQKIRRTVIDCFEKASLPTVSDEEKKRILHFAVVGGGPTGVEF
AAELHDFVNEDLVKLYPGVKDLVRITILEAGDHILNMFDKRITSFAEEKFQREGIDLKTG
SMVVKVTDKEIFTKEMKNGGEVSAMPYGMALWSTGIGTRPFIKDFMTQVGQGNRRALATD
EWLRVEGCDKVYAIGDCATINQRKVMEDIAAIFRKTDKDNSGTLTIDEYEEVIKDICERY
PQVELYLKSKQMKNMVDLLKETTDVSKGNVEFNIEDFKTALSKVDSQMKNLPATAQVAAQ
QGVYLAKCFNRMEEAEKNPEGPLRFRGEGRHRFRPFRYKHLGQFAPLGGEQTAAQLPGDW
VSIGHSSQWLWYSVYASKQVSWRNRSLVVTDWARRFIWGRDSSRI
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggtttcgctttcttcgaccgagtttctaaagccttccatgattatcctaaggct
tccaaaatgctcgtcgtcgtcgccgtcagtggcggtggctatgtggcttacgctgaggca
acccctgagccaaaactgatcagcagcgcgcctgtcatagatcaagtggacaataagaaa
cagaagattgtggtacttggaactggctgggctggaacaagtttcttgaggaatctgaaa
aatcccaactatgaggttcagatcatatcacctcggaattactttgccttcacccctctg
ctaccaagcgttacctgtggtacagtggaagctcgcagcattgttgaacccattcgaaac
attgttagaaagaaaaatgtggacgttcaattcactgaagctgcgtgtctgaagatcgat
gcacaaaacaataaaatctattgccattctaatctagaaaacaatttggatggacaagaa
gagtttgttgtggattatgactaccttattatagctgtgggagccaatgttaatacattc
aatactcctggtgtgatggagaactgccacttcttgaaggaagtggaagatgctcaaaag
attcgaaggactgttattgactgctttgaaaaggcaagccttccaactgtaagcgatgag
gagaagaagagaattcttcattttgctgttgtcgggggtggcccaactggtgtggaattt
gctgcagaacttcatgattttgtcaacgaggatttggtcaaattgtatcccggggtcaag
gatctagttagaattacaattctcgaggctggagatcatattctgaatatgtttgacaaa
agaatcacatcttttgctgaagaaaagtttcaaagagagggtattgatctgaaaacagga
tccatggttgtgaaagtaactgataaagaaatctttaccaaggaaatgaaaaatggcggg
gaagtatctgctatgccttatggaatggctctctggtcaactggtattggaacgcgtcct
ttcataaaggatttcatgactcaagttggtcagggtaatcgacgggctttagcaactgat
gaatggctgcgtgtggagggatgcgacaaagtgtatgcaattggtgattgtgccacaata
aatcagcgcaaagtcatggaggatattgctgccatattccgcaaaacggacaaggataat
tcaggaacacttacaatcgacgagtatgaagaagtgattaaggatatctgtgaaaggtat
cctcaggtggagctttatctgaagagcaaacagatgaaaaatatggttgatcttttgaag
gaaacaacggatgtttcaaaaggaaatgtggagtttaatattgaagatttcaagaccgct
ctttctaaagtggattcccagatgaaaaatcttccagccacagcccaggttgctgctcaa
caaggtgtctaccttgccaagtgtttcaaccgtatggaagaggctgagaaaaatcctgaa
ggtcctctcaggttccgtggagaaggtcgccatcggtttcgaccctttaggtacaagcat
ctggggcagtttgctccattgggtggagagcagacagcagctcagcttcctggagattgg
gtttccattggtcatagctcccagtggctttggtattctgtttacgctagcaaacaagtg
agctggcgcaacaggtcactggtggtaacggactgggctaggcgtttcatctgggggagg
gactcgagtcgcatttga

DBGET integrated database retrieval system