KEGG   Malus domestica (apple): 103446734Help
Entry
103446734         CDS       T03194                                 

Definition
(RefSeq) aminomethyltransferase, mitochondrial
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00260  Glycine, serine and threonine metabolism
mdm00630  Glyoxylate and dicarboxylate metabolism
mdm00670  One carbon pool by folate
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
mdm01200  Carbon metabolism
Module
mdm_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    103446734
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    103446734
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    103446734
Enzymes [BR:mdm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     103446734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-GeneID: 103446734
NCBI-ProteinID: XP_008384085
Position
10
AA seq 408 aa AA seqDB search
MRGASLWQLGQSITRRIAQGDKKAVARRYFASEAELKKTVLYDFHVANGGKMVPFAGWGM
PIQYKDSIIDSTINCRQNGSLFDVSHMCGLSLKGKDSISFLEKLVIADVASLAPGTGTLT
VFTNEKGGAIDDSVITKVTDDHIYLVVNAGCRDKDLAHIEEHMKAFKAKGGDVSWHIHDE
RSLLALQGPLAAPTLQHLTKEDLSKLYFGEFRILDINGAHCFLTRTGYTGEDGFEISVPD
ENAVDLAKAILEKSEGKVRLTGLGARDSLRLEAGLCLYGNDMEQHTTPVEAGLTWAIGKR
RRAEGGFLGAEVILKQLEEGPKIRRAGFISSGPPARSHSEIQNEKGETIGEVTSGGFSPC
LKKNIAMGYVKSXSHKAGTKVKIIVRGKAYDGAVTKMPFVPTKYYKPT
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagaggagcaagtttgtggcagcttggccagtcaatcacccggcgtattgctcagggt
gataagaaggctgtagctcgtcgatactttgcctcagaagctgagctaaaaaagacagtc
ctctatgacttccatgttgcaaatggcggtaagatggtgcctttcgctggatggggaatg
cctattcagtacaaggactcaatcatcgattccaccataaactgcaggcagaatggtagt
ctgtttgatgtctcccatatgtgtgggctgagccttaaggggaaggattccatatctttc
cttgaaaagctygtcattgctgatgttgcttcgcttgcccctggaacggggacactcact
gtctttacaaatgagaagggaggggcaattgatgactcygtgattaccaaggttactgac
gaccacatatacctggtggtgaatgctggatgtagggataaagatcttgctcacattgaa
gagcatatgaaggcattcaaggctaaagggggagatgtctcgtggcacatccatgatgag
agatctcttctagctctccagggtcctcttgctgccccaacccttcaacacttgacaaaa
gaggatttgagcaagttatattttggagagttccgaattttggatatcaatggtgcacac
tgctttcttacaaggactgggtacaccggtgaagatggatttgaaatctcggttcctgat
gagaatgcagtggatcttgcsaaggcaatcttggagaaatccgaggggaaggtgaggctg
acaggtctgggtgctcgtgacagtctccgactggaagctgggttgtgtttatatggcaat
gacatggagcaacacacaacacctgtggaggctggactcacatgggccatagggaagaga
agaagggcagagggcggctttcttggcgctgaggtaatactcaagcaactcgaggaaggt
cctaaaatccggcgtgctggtttcatctcatcaggtccacctgctagaagccacagcgag
attcagaacgagaaaggtgaaaccattggggaagtcacaagtggaggatttagcccctgc
ctgaagaaaaacatagcgatgggttacgtgaagtctgratcacacaaggccggaaccaaa
gttaagatcattgtccgaggaaaggcttatgatggagctgtcacgaaaatgcctttcgta
cctacaaaatactacaagccaacataa

DBGET integrated database retrieval system