KEGG   Malus domestica (apple): 103448183Help
Entry
103448183         CDS       T03194                                 

Definition
(RefSeq) tyrosine/DOPA decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00350  Tyrosine metabolism
mdm00360  Phenylalanine metabolism
mdm00380  Tryptophan metabolism
mdm00950  Isoquinoline alkaloid biosynthesis
mdm00965  Betalain biosynthesis
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103448183
   00360 Phenylalanine metabolism
    103448183
   00380 Tryptophan metabolism
    103448183
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    103448183
   00950 Isoquinoline alkaloid biosynthesis
    103448183
   00965 Betalain biosynthesis
    103448183
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdm04147]
    103448183
Enzymes [BR:mdm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     103448183
    4.1.1.105  L-tryptophan decarboxylase
     103448183
Exosome [BR:mdm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103448183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 DUF1148
Motif
Other DBs
NCBI-GeneID: 103448183
NCBI-ProteinID: XP_008385661
Position
1
AA seq 495 aa AA seqDB search
MPSALDPVEFRRQGHMMVDFIADYYQNIEKYPVLSQVEPGYLRKCLPESAPDNPEPIESI
LQDVQKHIVPGLTHWQSPSFFAYFASNVSIAGFLGEMLSTGFNVVGFSWVSSPAATELES
IVMDWLGNLLTLPKSFLFSGNGGGVIHGSTCEAIICTMVAARDQMLRQIGLDNIQKLVVY
GSDQTHSALQKACQIVGINPNNFRVIKTTKSTLFALSPESLKLAISSDVEAGLMPLFLCA
TVGTTATTAVDPLDSLCQVAKYYGIWVHVDAAYAGSACMCPEFRHFIDGVEGANSFSLNA
HKWLFTALDCCCVWIKDPSTLTSSLSTNPEFLRNKATDSKQVVDYKDWQIALSRRFRAMK
LWLVLKSYGAVNLRNYLRSHVKMAMLFEGLVSTDRRFEVVVPRVFSMVCFRVSPSAAIII
SDDEINVENHINEVNRKLLEGINASGHAFMTHAVVGGMYVIRCAIGVTLTEEKHIAMAWK
LVQEHADAILMKNNI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgctctggaccctgtggaatttaggaggcaaggccacatgatggtagacttc
atagcagattactaccaaaatatagagaagtacccagtcctaagtcaagttgaaccgggt
tatctccgaaagtgcttgccggagtctgccccagataacccagagcccattgaatccatc
ctccaagatgtgcagaaacacattgtgcctggcctgacacattggcaaagtcctagtttc
tttgcatactttgcttcaaatgttagcattgctgggtttcttggtgaaatgcttagcact
ggattcaacgtggtgggattcagttgggtatcttcaccagctgcaactgagctcgaaagc
attgtcatggactggcttggaaacctgcttacgcttcccaaatctttccttttctccggc
aatggtggcggtgtaatacatggtagtacttgtgaggccattatttgcaccatggtagcc
gccagggatcaaatgctaaggcaaattggtctagacaacatccagaagttagttgtgtac
gggtcagatcaaacacacagtgcacttcaaaaagcttgccaaattgttggtatcaaccca
aacaatttccgggtcatcaaaactacaaagtcaacattatttgccttatcacctgaatcc
ttaaaattggcaatttcttcagatgttgaagctgggctaatgccattgtttctatgtgct
accgttggtacaactgcgaccactgcggttgatccactggactcactatgccaagtggca
aaatattatggcatatgggttcatgtggatgcggcatatgcaggaagtgcctgcatgtgc
cctgaatttcgccatttcattgatggtgttgagggtgcgaattcattcagtcttaatgcg
cacaaatggctcttcactgcactcgactgttgctgtgtttggattaaagatccaagcaca
ttaacaagttcattgtcaactaatcccgagtttttgaggaacaaggccactgactcaaag
caagtggtggactacaaagactggcaaatagccctaagccggaggttccgggccatgaaa
ctatggcttgtgcttaagagctatggcgctgttaacctcaggaactatcttaggagccac
gtcaaaatggccatgctttttgaagggcttgtttccacggacagaaggtttgaggttgtg
gtgcctagggttttctccatggtttgttttagggtttcaccgtctgctgcaataataatt
agtgatgatgagattaatgtcgaaaaccatataaatgaggttaatcgaaagttactggag
ggcatcaatgcatcaggtcatgcgttcatgactcacgctgtggttggaggtatgtatgtg
atacgctgcgcaatcggtgtaacgttgacggaagaaaaacacatagccatggcctggaag
ttggttcaggagcatgcagatgccatcctcatgaaaaataatatataa

DBGET integrated database retrieval system