KEGG   Malus domestica (apple): 103449393
Entry
103449393         CDS       T03194                                 

Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00100  Steroid biosynthesis
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
Module
mdm_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    103449393
Enzymes [BR:mdm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     103449393
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 103449393
NCBI-ProteinID: XP_028946330
Position
12
AA seq 369 aa
MDLGHLLHLLIPSWNSVAILALFFTYLAIAGSILPGKLVPGATLPDGSRLHYRCNSLLSL
LVLVGLLGVGAKMDIVLLNAISDRGLELLSTTFLFSVLVTLVLYAVGCKSTNQGSSLKPH
VTGNLLDDWCFGIQLNPRFMGIDLKFFFVRAGMMGWLFINLSVLARSVQDGTLSQSMILY
QLFCTLYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLSNKVELG
TAGIVANCLTFLIGYLVFRGANKQKHIFKKNPKAPIWGKPARVIGGKLLASGYWGIARHC
NYLGDLLLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDEARCAEKYREIWAEYRRLV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctgggtcatcttctccacctcctaattccctcatggaactctgttgctattctg
gcattgttcttcacttacttggccattgctggatcgatactgcccggaaaacttgtcccc
ggagccactttaccggacggctctcggcttcattatcgatgcaatagtctgctatcactt
ctggtgctggttgggcttcttggggttggcgctaagatggatatcgtgttgcttaatgca
atatcagatagaggactagagctgttatcaacaacttttctgtttagtgttctggtcaca
ctggtactttacgctgtgggctgcaagtcgaccaaccagggttcttccctaaaacctcat
gtcacagggaaccttcttgatgactggtgctttggaatacagcttaatccccggtttatg
ggcattgacctcaaatttttctttgttagagctggaatgatgggctggctatttatcaac
ctttcggttctcgccagaagtgttcaagacggtaccttgagtcaatcaatgatcctctat
cagttgttctgtacgttatacatcttggactactttgttcatgaggagtacatgacctcc
acatgggacataatcgcagagagactgggcttcatgctggtatttggagatctagtctgg
attccgtttactttcagtatccagggatggtggcttctgagtaacaaggtggagttagga
acagcgggtatcgtagcaaattgcttgacttttctgattgggtacctagtattccgagga
gccaacaagcaaaagcatatctttaagaagaatccgaaagcacccatatggggtaagccc
gcgagggtcattgggggaaagttgcttgcttctggttattggggaattgcaaggcactgt
aattacctcggggacttgttactagcactgtctttcagcttaccttgcgggataagttcc
ccagttccatacttctatccaatttatcttcttattctgctcatatggagagaaagaaga
gatgaagctcgttgtgccgagaagtacagagagatctgggccgaataccgccggcttgtt
ccgtggagaatattaccttacgtttactaa

DBGET integrated database retrieval system