KEGG   Malus domestica (apple): 103452121Help
Entry
103452121         CDS       T03194                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
mdm  Malus domestica (apple)
Pathway
mdm03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103452121
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mdm03041]
    103452121
Enzymes [BR:mdm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     103452121
Spliceosome [BR:mdm03041]
 Complex C
  Other components
   Step II factors
    103452121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_30 AAA_19 T2SSE ABC_tran Sigma54_activ_2 cobW DUF2075 AAA_16 ATPase_2 MMR_HSR1 AAA_33 Helicase_RecD AAA_14 DAP3 AAA_29
Motif
Other DBs
NCBI-GeneID: 103452121
NCBI-ProteinID: XP_008389836
Position
13
AA seq 700 aa AA seqDB search
MADLPILQFEDTIMKAVEENPVVVVIGETGSGKSTQLSQILHRRGYTKSGVVGVTQPRRV
AAVSVARRVSQELGVRLGDEVGYAIRFEDRTSERTRIKYLTDGVLLRESLSNPELDQYSV
IILDEAHERSLNTDILLGLMKRLVKRRASNFKVLITSATLDGEKVSQFFSNCPVVKVPGK
LFPVEIAYSRERPASYLESSLETALNIHIKQGEGDVLIFMTGQDDIDKLVLKLEERVRSL
EEGSCMDAIILPLHGSLQPEMQVRVFGPRPPNCRRFIVATNIAETSLTVDGVVYVIDSGY
VKQRQYNPSTGMYSLDVVQISKVQANQRAGRAGRTRPGKCYRLYPSTVYEDEFLDATIPE
IQRSSLAGSVLYLKSLDLPDIDILKFDFLDSPSPESLQDALKQLYLIDAIDENGLITRVG
KTMAELPLEPSLSKTLMEANEYGCLSQALTVAAMLSAETTLLPGRSKSTEKKRKHDYLDL
PDGSGWGDHIQLLQIYECWHQTDYDINWCKDYQLQVRGMKFVKDVRKQLSQIMQKIAKGS
LDVQTARRRNESQQDYHNLRKALCVGYANQLAERMMHHNGYRTLGFKPQVVQVHPSSVLK
PDDEGKLPDYVVYHELIATTRPFLRTVCAVNVAWVRPILDKVNNLNIKKLSGGIGRIEEQ
PEGNLSDLPKKEDVVAPVLDDRESRVQAARERFLARKGKK
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggcggacctaccaatcctccaattcgaggacacaatcatgaaagcagtagaagaaaac
cccgtcgtagtggtgatcggagagacaggttcgggaaagagcacgcagctctctcagata
cttcacagaaggggctacaccaagtccggagtcgtcggcgtcactcagccccgccgagtc
gccgccgtctccgtcgccagacgagtttcgcaggagctcggcgttcggcttggggacgaa
gttggatacgccatcagatttgaagatagaacttcggaaaggacgcggattaagtacctc
accgatggagttcttcttcgtgaaagcctctccaatccagagcttgatcagtactctgta
atcatactagatgaagctcacgaaaggagtctaaacacggacatactgctgggactgatg
aaacgcttggtgaaaaggcgtgcctcgaatttcaaggttctaatcacttcagcaactctt
gatggcgaaaaagtatcacaattcttttcaaattgccctgtagtgaaagtccccggcaag
ttattcccggtcgaaatagcctacagccgtgagcgccctgccagctatcttgagtcatct
ctagaaacagctctcaatatacatattaagcaaggcgaaggcgatgtcttgattttcatg
actggacaggatgatatagacaagttggtgttgaagttagaagagagagttcgaagcctg
gaagaagggtcttgcatggatgccataatccttcctcttcatggttctttgcagcccgaa
atgcaggtacgtgtttttggtcctcggcctccaaattgtaggagatttattgttgcaaca
aatattgctgaaacttctttgactgtagatggtgttgtgtatgttattgattctggttac
gtgaagcaacgacagtacaacccatcaactggcatgtattccctcgatgttgttcaaatt
agcaaggtacaagcaaatcaacgtgcaggacgagcaggaagaacacgtcctgggaagtgc
tatcgtttatacccttcgacggtttacgaggatgagttccttgatgcaacaattcctgaa
atacaacgctcttcgcttgctggaagtgttctctatttgaaatctttggacctccctgat
attgacattctaaaatttgattttcttgattctccttcccctgagtctttacaagatgct
ttgaagcagttgtatcttattgatgctattgatgaaaatggattgatcacaagagttgga
aaaacaatggctgagcttccgctagaaccttcactgtcaaagaccttaatggaggcaaat
gagtatggctgcttatcgcaggctttgactgttgctgctatgttatctgcagaaaccaca
ttgcttcctggtcgaagcaaaagtacggagaagaagaggaaacatgattatttggacctt
cctgatggctctggttggggtgatcatatccagttgctacagatctatgagtgctggcat
caaactgactatgacattaattggtgcaaggattatcagttgcaggtgagagggatgaag
tttgtcaaggatgtaaggaaacagttatctcaaatcatgcagaaaatagcaaaaggatca
ttagatgtacagacagccagaagacggaatgaaagccaacaagattatcacaatttgagg
aaggctttgtgcgtgggatatgcaaatcaacttgctgagagaatgatgcatcacaatggt
tatcgaactttaggttttaagccccaagtagtacaggtgcatccatcctctgtgctaaaa
ccagatgatgaagggaaattgcctgactatgttgtgtaccatgaactcattgcaacaacc
cgcccattcctgcgcactgtatgtgccgtaaatgttgcttgggtcagaccaattttggac
aaagtgaataatctaaacatcaagaagctgagtggcgggattggtcgtattgaagagcaa
ccggagggaaatctttccgatttgccaaagaaagaggatgttgttgcgccggtccttgac
gatcgggaaagtagagtacaggcggctagggaacgatttcttgctcgtaaaggaaagaaa
tga

DBGET integrated database retrieval system