KEGG   Malus domestica (apple): 103452346Help
Entry
103452346         CDS       T03194                                 

Definition
(RefSeq) glutathione S-transferase U17-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00480  Glutathione metabolism
mdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103452346
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mdm02000]
    103452346
Enzymes [BR:mdm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103452346
Transporters [BR:mdm02000]
 Other transporters
  Pores ion channels [TC:1]
   103452346
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_C_2 GST_N_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 103452346
NCBI-ProteinID: XP_028947459
Position
13
AA seq 231 aa AA seqDB search
MAKSDVKVLGAWPSPYAMRAWIALNIKSVEYELLEETFEAKSQLLLQSNPVHKKIPVLIH
CDKSVCESLIIVEYIDEVWASGPSILPSDPLDRATARFWAAYVDEKWLPSLRGVAAAEGD
EAKKAAVEQVAEGLAQMEEAFQKTSKGKDFFSGDKIGYLDIAFGCFLGWLRVTEKMNGVK
LLDEAKIPGLAKWAEKFSADPAVKDVMPETDKLAEVTKILKARLRAAGASK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagagcgacgtgaaggttttgggagcgtggccgagcccatacgcgatgagggct
tggatcgcgctcaatatcaagtcagtggagtatgagcttcttgaggagacgttcgaagcc
aaaagccagcttcttctccagtccaatccagtccacaagaaaatcccagttctcattcat
tgtgataagtccgtctgtgagtctctcatcattgtggagtacatcgatgaggtttgggcc
tcaggcccgtcgattctcccttctgacccgttggatcgcgctactgcaagattttgggct
gcctacgtcgatgagaagtggcttccatcgctgagaggcgttgctgccgctgaaggagac
gaggcaaagaaggcagcagtcgagcaagttgcagaagggctggctcaaatggaggaagcc
tttcaaaagaccagcaaaggcaaggacttcttcagtggggacaaaattgggtacctggac
attgcattcgggtgcttcttggggtggctcagagtgacagagaaaatgaatggggtcaaa
cttctggacgaagcaaagatcccagggctggccaaatgggctgagaagttcagtgcagat
cctgctgtgaaggatgttatgccggagactgacaagttggctgaggttactaagattctt
aaggccagattgagagctgcaggtgcttccaagtga

DBGET integrated database retrieval system