KEGG   Malus domestica (apple): 103452647Help
Entry
103452647         CDS       T03194                                 

Definition
(RefSeq) glycine--tRNA ligase, mitochondrial 1-like
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103452647
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mdm01007]
    103452647
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mdm03016]
    103452647
   03029 Mitochondrial biogenesis [BR:mdm03029]
    103452647
Enzymes [BR:mdm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     103452647
Amino acid related enzymes [BR:mdm01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   103452647
Transfer RNA biogenesis [BR:mdm03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    103452647
Mitochondrial biogenesis [BR:mdm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    103452647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HGTP_anticodon tRNA-synt_2b
Motif
Other DBs
NCBI-GeneID: 103452647
NCBI-ProteinID: XP_008390393
Position
13
AA seq 649 aa AA seqDB search
MSAASSLQSRAAGGTKPDIDAANEALNPMDEDLKVSSSVGALKVTRQVPSRQAMAKMLQE
RLFYIPSFKIYDGAAETAGLFDYGPPGVKLKNNVLAFWRQHFVLGENMLEVECPSVTPEI
VLKASGHVDRFTDLMVKDEKNGNCYRXDHLLKDFCTEKLQKDLNIAEEKAKELKHVLALL
DDLSAEELGAKIKEYGITAPDTSNPLSDPYPFNLMFQTSIGPSGSSTAYMRPETAQGIFV
NFNYLYYYNGNKLPFAAAQIGQAFRNEIAPRQGLLRVREFTLAEIEHFVDPEDKTHPKFN
EVAELEFQMFPREEQVSGQSARIIRLGEAVAKGIVDNQTLAYFIGRVYLFLTRLGIDEER
LRFRQHLPNEMAHYAADCWDAEIETSYGWIECVGIADRSAYDLQAHSVKSNKDLMAHEKF
SEPREVEELVISPVVKETGLAFKADGKNVVEALKAMNEKEALEMKADLEAKGEVEFYVCT
LGKNVSIKQNMVTISYKKRKEHQRRFTPSVIEPSFGIGRIIYCLFEHSYYTRQSQAGDEQ
SNNLNVLRFPPLMAPFKCTVFPLVQNKEYEEVAKGISKSLTAAGISHKIDITGTSIGKKY
ARTDELGAPFAITVDSTTSVTIRERDSKDQVRVNLKEVVVVVKELTAGA
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgcctcttcgctgcaatcgagagctgccggcggcaccaaaccggatattgac
gccgcaaacgaagccttgaacccgatggacgaggaccttaaggtctctagcagcgttggc
gcgcttaaagtcactaggcaggtgccatctcgtcaagccatggcgaaaatgctgcaagag
cggttgttttacatcccgtccttcaaaatctacgacggcgctgcggaaaccgctgggctt
ttcgactacgggcctcccggcgtcaagttgaagaacaacgttcttgcattttggcgtcag
cattttgttcttggggagaacatgytagaagtcgagtgcccgtctgtcacgcccgagatc
gttctgaaagcgtcggggcacgtagacagattcactgaccttatggttaaggacgagaag
aacgggaactgctaccgcgyagaccacttgctgaaggatttctgcaccgagaagcttcag
aaggatctcaacatcgccgaagagaaggcgaaggaactcaaacatgtactcgctctgtta
gatgacctctcagctgaagaactaggtgcaaagatcaaagagtatgggattacagcccct
gacacgagcaatcctctgtctgatccctatccatttaacttaatgttccaaacgtcaatt
ggtccgtctggctcgagcactgcgtacatgagaccggaaactgcacaaggcatatttgtg
aacttcaactatttgtactactacaatggcaacaagctaccttttgctgcggctcaaatc
ggccaagcctttcgaaatgagattgctcctcgccaagggcttttaagagtccgtgagttc
acactcgcggagattgaacactttgtagatcctgaagacaaaactcacccgaagtttaat
gaggtcgcggagttggagttccaaatgtttccgagggaagaacaggtatctggccagtct
gcaaggataatccgcttgggtgaagcagttgcaaagggcatagtcgacaatcagacttta
gcctatttcatcggccgagtctacctcttcctcacacggttgggtatagacgaggagcgt
ctaaggttccgccagcacctgccgaatgaaatggcgcactacgctgctgactgctgggat
gctgagatcgagacttcatacgggtggattgagtgcgtcgggatagcagatagatctgca
tatgatcttcaagctcattcagtaaaaagtaataaagatcttatggctcatgaaaaattt
tcagaaccaagagaagtggaggaactggttatatctccggtggttaaagagaccggcctt
gctttcaaggcggacggaaagaatgtagttgaagcactgaaggccatgaatgaaaaagaa
gctttggagatgaaagcggatttagaggcgaagggcgaggtggagttttatgtctgcaca
ctagggaaaaatgtatcaataaagcagaatatggtgacgatttcatacaagaaaaggaaa
gaacaccagagaagattcacaccctcagtgatcgaaccttcgtttggtatcgggcggatc
atctactgcctcttcgagcattcatactacaccagacaaagtcaagctggggatgaacag
tcgaacaacttgaacgtgctccgtttccctcctctcatggcgccctttaagtgcacggtt
ttcccgctggttcagaacaaggagtatgaggaggttgctaaaggcatttccaagtcactg
accgcagctggcatatcacataaaatcgacattacaggcacctctatcgggaaaaagtat
gcacggactgacgagcttggtgcgcccttcgcgatcacggtggattctacaacgtcagtg
acaattcgggagagagacagcaaggatcaggttcgtgtaaatttgaaagaggtagtggtc
gttgtgaaggagctaactgcgggggcttaa

DBGET integrated database retrieval system